BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1189 (463 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 23 5.2 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 23 5.2 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 23 6.9 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 23 6.9 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 22 9.1 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 23.0 bits (47), Expect = 5.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 400 HCACQYVVATPGSFCPIDRPLFVLCGPA 317 HCAC Y P C + L + CG A Sbjct: 21 HCACPYAHPYPYDLCGPNEEL-LECGTA 47 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 23.0 bits (47), Expect = 5.2 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -1 Query: 400 HCACQYVVATPGSFCPIDRPLFVLCGPA 317 HCAC Y P C + F CG A Sbjct: 21 HCACPYAHPYPYDVCGPNEE-FQTCGTA 47 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 22.6 bits (46), Expect = 6.9 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 Query: 306 KWQWAGPHSTKRGRSMGQKDPGVATTYWQA 395 +W G + KRG++ +A+ +W A Sbjct: 51 QWTATGEPAPKRGKTQKSAGKVMASVFWDA 80 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 22.6 bits (46), Expect = 6.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -1 Query: 400 HCACQYVVATPGSFCPIDRPLFVLCGPA 317 HCAC Y P C + F CG A Sbjct: 21 HCACPYAHPYPYDLCGPNEE-FQECGTA 47 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 22.2 bits (45), Expect = 9.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 422 HLVGGRPTLRLPVRGRHSRIFLPHRPSS 339 H G P R+P+ R S+ LP +P + Sbjct: 501 HPNDGEPAPRVPIFIRKSQFRLPPKPET 528 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 476,089 Number of Sequences: 2352 Number of extensions: 8102 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -