BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1186 (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.07 |||signal recognition particle subunit Srp21 |Schizo... 26 5.3 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 26 5.3 SPBC1734.01c ||SPBC337.17c|RNA-binding protein|Schizosaccharomyc... 25 9.2 SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|ch... 25 9.2 >SPAC17H9.07 |||signal recognition particle subunit Srp21 |Schizosaccharomyces pombe|chr 1|||Manual Length = 120 Score = 25.8 bits (54), Expect = 5.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 1 EIPTAPEGQALVKPNGHGLFSQPRAPPK 84 EIP PE + + P ++P APPK Sbjct: 82 EIPPEPEQEVVASPVTEQKKAEPSAPPK 109 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 25.8 bits (54), Expect = 5.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 202 PRRPSSSGKTSTVQRPRPNQLKERNSNLP 288 P RP+S+G++S R R + L + LP Sbjct: 538 PNRPASNGRSSLFSRGRASNLGDVGLRLP 566 >SPBC1734.01c ||SPBC337.17c|RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 682 Score = 25.0 bits (52), Expect = 9.2 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +1 Query: 241 QRPRPNQLKERNSNLPDLKL*TSQERRKDQKNMMTIIITNL 363 ++ R NQL++ P+LK+ + + DQ+ + I+ ++ Sbjct: 637 RKRRSNQLEQTQDGKPELKIKKRKAEKGDQRQELDRIVKSI 677 >SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 244 Score = 25.0 bits (52), Expect = 9.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 7 PTAPEGQALVKPNGHGLFSQPRAPPKIKRPVPLSEK 114 P +PEG+ L + H P + +RPV +K Sbjct: 119 PFSPEGEGLERKREHEKLQAPSPKEEEERPVDQGDK 154 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,297,028 Number of Sequences: 5004 Number of extensions: 40660 Number of successful extensions: 95 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -