BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1183 (577 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 6.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 6.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 6.6 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 369 NIPHSSENETPTSDNDNQSLKNTKSTQTPKVKTSDT 476 NI +N+ S+ND +NT S + + S T Sbjct: 361 NIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSAT 396 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 369 NIPHSSENETPTSDNDNQSLKNTKSTQTPKVKTSDT 476 NI +N+ S+ND +NT S + + S T Sbjct: 399 NIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSAT 434 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 6.6 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -2 Query: 438 WYFLKIGCHC 409 WY GCHC Sbjct: 240 WYLPSGGCHC 249 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,641 Number of Sequences: 438 Number of extensions: 3334 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -