BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1178 (538 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 21 6.9 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 21 9.1 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 21 9.1 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -3 Query: 305 DKESH*SNRRRYPSLGEQKAELEEDHHHLENPIWGWGDKDMSDDDKKLAEIV--HKKND 135 D H S RR A DHHHL GD+ ++ D + V +K++D Sbjct: 1156 DPSGHISRRR------SMSASSRGDHHHLGAVTEEGGDESANETDSETVSTVPQNKRDD 1208 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -3 Query: 305 DKESH*SNRRRYPSLGEQKAELEEDHHHLENPIWGWGDKDMSDDDKKLAEIV--HKKND 135 D H S RR A DHHHL GD+ ++ D + V +K++D Sbjct: 1156 DPSGHISRRR------SMSASSRGDHHHLGAVTEEGGDESANETDSETVSTVPQNKRDD 1208 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -3 Query: 305 DKESH*SNRRRYPSLGEQKAELEEDHHHLENPIWGWGDKDMSDDDKKLAEIV--HKKND 135 D H S RR A DHHHL GD+ ++ D + V +K++D Sbjct: 1156 DPSGHISRRR------SMSASSRGDHHHLGAVTEEGGDESANETDSETVSTVPQNKRDD 1208 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -3 Query: 305 DKESH*SNRRRYPSLGEQKAELEEDHHHLENPIWGWGDKDMSDDDKKLAEIV--HKKND 135 D H S RR A DHHHL GD+ ++ D + V +K++D Sbjct: 1156 DPSGHISRRR------SMSASSRGDHHHLGAVTEEGGDESANETDSETVSTVPQNKRDD 1208 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.0 bits (42), Expect = 6.9 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 Query: 194 DKDMSDDDKK 165 D DM+DDD+K Sbjct: 198 DDDMNDDDRK 207 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 20.6 bits (41), Expect = 9.1 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 471 SPQFCYQLLLCIDIW 515 S C+ +LL ++IW Sbjct: 166 SATVCFMMLLMLEIW 180 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 20.6 bits (41), Expect = 9.1 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 471 SPQFCYQLLLCIDIW 515 S C+ +LL ++IW Sbjct: 162 SATVCFMMLLMLEIW 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,025 Number of Sequences: 336 Number of extensions: 2813 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -