BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1177 (614 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0587 + 30162806-30163183,30163315-30163478,30163571-301636... 30 1.7 >02_05_0587 + 30162806-30163183,30163315-30163478,30163571-30163654, 30163737-30163794,30164092-30164145,30164244-30164309, 30164310-30164381,30164547-30164627,30165361-30165533, 30165916-30166018,30166148-30166279,30166432-30166554, 30166898-30167002,30167397-30167722,30167919-30168258, 30169973-30170113,30170589-30170801,30170901-30171119, 30171272-30171619,30171711-30172043,30172548-30172601 Length = 1188 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 516 SSKWSAYVVILPEQKHHCIS*NTVGTHSYLVVGPL 412 SS+WS+Y+ LP Q + + +YLV P+ Sbjct: 161 SSRWSSYIAALPRQPYSLLYWTRPELDAYLVASPI 195 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,881,519 Number of Sequences: 37544 Number of extensions: 355098 Number of successful extensions: 805 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -