BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1172 (604 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 3.5 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 3.5 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.1 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 6.1 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 99 PHPRLQRSPCRLLRNPSRGQPGP 167 PHP L P L +P+ PGP Sbjct: 232 PHPGLSPHPPHLSSHPAIVTPGP 254 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 99 PHPRLQRSPCRLLRNPSRGQPGP 167 PHP L P L +P+ PGP Sbjct: 124 PHPGLSPHPPHLSSHPAIVTPGP 146 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = -2 Query: 468 VVPKNVNAAIATIKTKRTIQFVDLVSNRFQGRYQLPATH 352 V P N+ A + F++L++ F G+++ H Sbjct: 253 VGPDNIKAGYDVPAVSSYLDFINLMAYDFHGKWERETGH 291 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.2 bits (45), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 503 VTWLAVCCTVVTSYPRM 453 + W VC VV YPR+ Sbjct: 164 LVWREVCTFVVQVYPRL 180 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 532 LVGGLEACVCDLG 570 L+GG +C CDLG Sbjct: 703 LMGGKWSCDCDLG 715 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -2 Query: 483 LYRGDVVPKNVNAAIATIKTKRTIQFV 403 L+ + KNV A K R +QFV Sbjct: 84 LFMTSQIKKNVTRAYCNKKIDRNLQFV 110 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -2 Query: 483 LYRGDVVPKNVNAAIATIKTKRTIQFV 403 L+ + KNV A K R +QFV Sbjct: 84 LFMTSQIKKNVTRAYCNKKIDRNLQFV 110 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 420 RTIQFVDLVSNRF 382 +TI+FV ++ NRF Sbjct: 177 QTIEFVSIIRNRF 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,385 Number of Sequences: 336 Number of extensions: 3552 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -