BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1164 (601 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/... 28 1.2 SPBPB8B6.06c ||SPAPB8B6.06c, SPAPB8B6.06c|conserved fungal prote... 26 4.8 SPAC977.11 |||conserved fungal protein|Schizosaccharomyces pombe... 26 4.8 SPBC11B10.07c |||CDC50 domain protein|Schizosaccharomyces pombe|... 25 8.5 >SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/acetylglutamate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 885 Score = 27.9 bits (59), Expect = 1.2 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +2 Query: 17 KTDLNLL-QRLVPTAIEKHISEREIT 91 K DLN+L L+P ++ HI EREI+ Sbjct: 741 KNDLNVLTNNLIPYSLTDHIHEREIS 766 >SPBPB8B6.06c ||SPAPB8B6.06c, SPAPB8B6.06c|conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 311 Score = 25.8 bits (54), Expect = 4.8 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 505 VLSYFTVFKHQLIT---KKPYNSIIMNAIMIFNLYYIVDYENRIGHG 374 VLS + F ++L T K+ Y I++ + F++ IVD GHG Sbjct: 260 VLSTLSTFSNELHTMPIKRAYIYCIISVAISFSICVIVDGATAWGHG 306 >SPAC977.11 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 311 Score = 25.8 bits (54), Expect = 4.8 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -1 Query: 505 VLSYFTVFKHQLIT---KKPYNSIIMNAIMIFNLYYIVDYENRIGHG 374 VLS + F ++L T K+ Y I++ + F++ IVD GHG Sbjct: 260 VLSTLSTFSNELHTMPIKRAYIYCIISVAISFSICVIVDGATAWGHG 306 >SPBC11B10.07c |||CDC50 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 371 Score = 25.0 bits (52), Expect = 8.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 134 IHEENFTENFSLFEYQVCCCIHFSTIKI 217 I+E N T NF + EY+ I FST + Sbjct: 293 IYEMNITYNFPVTEYKGTKTIMFSTTSV 320 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,044,511 Number of Sequences: 5004 Number of extensions: 34471 Number of successful extensions: 77 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -