BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1164 (601 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006683-1|AAK71395.4| 954|Caenorhabditis elegans Adenylyl cycl... 30 1.1 Z72503-3|CAE17724.1| 217|Caenorhabditis elegans Hypothetical pr... 28 4.4 >AC006683-1|AAK71395.4| 954|Caenorhabditis elegans Adenylyl cyclase protein 4 protein. Length = 954 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 71 ISEREITINNDP*ILRQGIDIIHEENF 151 +SE E+ + N LRQGI IH+EN+ Sbjct: 467 LSEEEVLVENVDSHLRQGIQAIHQENW 493 >Z72503-3|CAE17724.1| 217|Caenorhabditis elegans Hypothetical protein C26C6.9 protein. Length = 217 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 490 TVFKHQLITKKPYNSIIMNAIMIFNLYYIVDYENRI 383 T F H I+K NSI+ + I+ +YY + + N++ Sbjct: 132 TFFAHHQISKDIQNSIMASTHRIYKIYYHLKFYNQM 167 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,280,726 Number of Sequences: 27780 Number of extensions: 189869 Number of successful extensions: 385 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -