BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1163 (424 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY101765-1|AAM50084.1| 1885|Homo sapiens C3 and PZP-like alpha-2... 44 2e-04 AB033109-1|BAA86597.1| 1884|Homo sapiens KIAA1283 protein protein. 44 2e-04 >AY101765-1|AAM50084.1| 1885|Homo sapiens C3 and PZP-like alpha-2-macroglobulin domain containing 8 protein. Length = 1885 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = +1 Query: 73 VATDDNLQYQFF--PVSSGSVQFKVRAANDAHIALTTGPQESDPMYEVMIGGWGNAKSVI 246 ++T + ++Q+ P+ VRA NDA +AL++GPQ++ M E+++GG N +S I Sbjct: 953 ISTPNKYEFQYVQRPLRLTRFDVAVRAHNDARVALSSGPQDTAGMIEIVLGGHQNTRSWI 1012 Score = 32.7 bits (71), Expect = 0.52 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +3 Query: 294 ILNGGEYRGFWVRWDSGIISAGREGE---AIPFISWSDPEPFPVYY 422 IL+ E+R FW+ W G+I G E ++W+ P P V + Sbjct: 1029 ILSWDEFRTFWISWRGGLIQVGHGPEPSNESVIVAWTLPRPPEVQF 1074 >AB033109-1|BAA86597.1| 1884|Homo sapiens KIAA1283 protein protein. Length = 1884 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = +1 Query: 73 VATDDNLQYQFF--PVSSGSVQFKVRAANDAHIALTTGPQESDPMYEVMIGGWGNAKSVI 246 ++T + ++Q+ P+ VRA NDA +AL++GPQ++ M E+++GG N +S I Sbjct: 952 ISTPNKYEFQYVQRPLRLTRFDVAVRAHNDARVALSSGPQDTAGMIEIVLGGHQNTRSWI 1011 Score = 32.7 bits (71), Expect = 0.52 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +3 Query: 294 ILNGGEYRGFWVRWDSGIISAGREGE---AIPFISWSDPEPFPVYY 422 IL+ E+R FW+ W G+I G E ++W+ P P V + Sbjct: 1028 ILSWDEFRTFWISWRGGLIQVGHGPEPSNESVIVAWTLPRPPEVQF 1073 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,763,378 Number of Sequences: 237096 Number of extensions: 1413291 Number of successful extensions: 3465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3465 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3259265358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -