BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1150 (611 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0036 + 3217163-3217584,3217752-3218322 32 0.41 11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244... 30 1.3 11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557... 30 1.3 01_06_1665 - 38988014-38988078,38988459-38988546,38988921-389890... 29 2.2 04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902,420... 29 2.9 11_04_0045 + 12731603-12732487,12732572-12732647,12744290-12745371 28 5.1 02_05_0136 + 26174965-26175849,26176965-26177030,26177124-261772... 28 5.1 06_01_0092 - 775290-775691 28 6.7 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +2 Query: 251 ECITIHWPSFYNVV-TGKTLALPNLIALQH 337 E I+ W F N+V +G TL++PN + LQH Sbjct: 67 ESISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >11_06_0294 + 22022630-22024006,22024109-22024234,22024319-22024423, 22024525-22024659,22024798-22024847,22026487-22026545, 22026819-22026928,22027941-22028174,22028278-22028377, 22028699-22028829,22029834-22029914,22029970-22030128 Length = 888 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 319 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 462 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 446 >11_06_0278 - 21854859-21855101,21855529-21855587,21855684-21855711, 21855812-21856702,21856792-21857011,21857638-21857687, 21863174-21863284,21863379-21863483,21863568-21863693, 21863796-21865187 Length = 1074 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 319 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFAL 462 L+R + PF SW N +A D+ + L LNG + + LK L Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNGRAAALIEKVNLKRGL 451 >01_06_1665 - 38988014-38988078,38988459-38988546,38988921-38989082, 38989268-38989359,38989896-38990007,38990040-38990181, 38990448-38990668 Length = 293 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = +3 Query: 141 ELNQQLDDFKTPASVQCVYNPTK-------YARGGARYPIRPIVSVLQFT 269 E+ + D F T + YN TK Y RGG +Y + IVS ++F+ Sbjct: 168 EIQDEYDYFSTALYLYSKYNVTKALKKAHIYPRGGRKYLVGHIVSAIEFS 217 >04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902, 4208006-4208297,4209278-4209569,4210013-4210465 Length = 783 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 248 SECITIHWPSFYNVV-TGKTLALPNLIALQH 337 +E I W F N+V +G TL+LP + LQH Sbjct: 126 NESIGAAWSRFTNLVQSGPTLSLPEYVLLQH 156 >11_04_0045 + 12731603-12732487,12732572-12732647,12744290-12745371 Length = 680 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +2 Query: 251 ECITIHWPSFYNVV-TGKTLALPNLIALQH 337 E I W F N+V +G TL+LP + LQH Sbjct: 408 ESIGAAWSRFTNLVQSGLTLSLPEYVLLQH 437 >02_05_0136 + 26174965-26175849,26176965-26177030,26177124-26177258, 26177369-26177434,26177516-26177701,26177777-26177863, 26177985-26178098,26178174-26178298,26178375-26178483, 26179298-26179423,26179511-26179831,26180146-26180269, 26180405-26180529 Length = 822 Score = 28.3 bits (60), Expect = 5.1 Identities = 22/74 (29%), Positives = 35/74 (47%) Frame = +3 Query: 135 IDELNQQLDDFKTPASVQCVYNPTKYARGGARYPIRPIVSVLQFTGRRFTTS*LGKPWRY 314 +DE ++L++ V+ + NP +Y R GAR P ++ L TG+ + Sbjct: 351 VDEAKEELEEI-----VEFLRNPERYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEV 405 Query: 315 PT*SPCSTSPFRQL 356 P S CS S F +L Sbjct: 406 PFIS-CSASEFVEL 418 >06_01_0092 - 775290-775691 Length = 133 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 377 RASSLLRQLAKGGCAARR 324 RA+SLLRQL + GCAA + Sbjct: 22 RAASLLRQLIEDGCAAAK 39 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,464,578 Number of Sequences: 37544 Number of extensions: 369426 Number of successful extensions: 960 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -