BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1150 (611 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. 30 5.6 AM081630-1|CAL05776.1| 101|Homo sapiens immunoglobulin heavy ch... 30 7.4 >AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. Length = 1857 Score = 30.3 bits (65), Expect = 5.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 269 WP-SFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPN 397 WP S +TGK A +L+ + +P G K P P+A PN Sbjct: 1754 WPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPN 1797 >AM081630-1|CAL05776.1| 101|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 101 Score = 29.9 bits (64), Expect = 7.4 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = -1 Query: 314 VTPGFSQSRRCKTTASEL*YTHYRANWVPGPPSSIFSRIINTLDGGWC 171 V PG S C TASEL +++Y +WV P + D G C Sbjct: 15 VQPGGSLRLSC--TASELTFSNYAMSWVRQAPEKGLQWVSTICDSGGC 60 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,158,587 Number of Sequences: 237096 Number of extensions: 2138924 Number of successful extensions: 7742 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7742 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -