BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1150 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 21 7.2 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 7.2 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 7.2 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 21 7.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 9.5 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 326 ALQHIPLSPAGVIAKRPAPIALPNSC 403 AL P P G K AP+ L +C Sbjct: 55 ALGEAPCDPVGRRLKSLAPLVLRGAC 80 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = +3 Query: 132 YIDE-LNQQLDDFKTP 176 Y DE L + +D+FKTP Sbjct: 312 YSDEDLREAIDEFKTP 327 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 601 ESTFFNSGLLFQTGTTLNPI 542 E + SG L+ TT+NPI Sbjct: 307 EWLYILSGCLYYFSTTINPI 326 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 326 ALQHIPLSPAGVIAKRPAPIALPNSC 403 AL P P G K AP+ L +C Sbjct: 55 ALGEAPCDPVGRRLKSLAPLVLRGAC 80 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +2 Query: 236 NSPYSECITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 358 N Y+ + P +YN++ + + +P I + P P G Sbjct: 321 NYNYNNYNNNYKPLYYNIINIEQIPVPVPIYCGNFPPRPMG 361 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,514 Number of Sequences: 438 Number of extensions: 3951 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -