BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1146 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0661 + 4968089-4969741 29 2.7 09_02_0315 - 7179332-7179949 29 4.7 10_08_0771 + 20463872-20465113 28 8.1 >07_01_0661 + 4968089-4969741 Length = 550 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 151 LGHNDLILCRHCP*TCSYPQPHVQLRRTVVGIALLNKIPIG 273 L H L+L R T S P PHV L + A L+ +P G Sbjct: 42 LAHRALLLFRSLQSTPSPPPPHVSLPAVLSAAAFLSALPEG 82 >09_02_0315 - 7179332-7179949 Length = 205 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 685 GRQRLGSAPGIAEVHGRR*PLTIRWVVCSYAYKGN 581 GR G A +AEV P + WV+CS+ Y+GN Sbjct: 80 GRVPRGGAR-VAEVLIEPGPERVAWVLCSWGYEGN 113 >10_08_0771 + 20463872-20465113 Length = 413 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 196 CSYPQPHVQLRRTVVGIALLNKIPIGSAIVEI 291 CSY P QLR G A + IG+A V + Sbjct: 135 CSYKGPPTQLRGNTSGFAATDTFAIGTATVRL 166 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,069,241 Number of Sequences: 37544 Number of extensions: 423381 Number of successful extensions: 742 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -