BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1145 (600 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.10 |mcp1||sequence orphan|Schizosaccharomyces pombe|chr... 29 0.39 SPAC23H4.06 |gln1||glutamate-ammonia ligase Gln1|Schizosaccharom... 29 0.39 SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma c... 27 2.1 SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosacch... 27 2.1 SPAC23A1.18c |mrp51||mitochondrial ribosomal protein subunit L51... 25 6.4 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 25 6.4 >SPAC1687.10 |mcp1||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 661 Score = 29.5 bits (63), Expect = 0.39 Identities = 28/118 (23%), Positives = 46/118 (38%), Gaps = 6/118 (5%) Frame = +2 Query: 242 GIRYGPAPPCVAATFEQSDPP----RDIIDAHKSNKQNGMIKLKGTLAREVASAWECRVG 409 G R+GP PC++ S P ++I+ + N +KL G+ + + + Sbjct: 512 GSRHGPREPCLSPDASSSSIPVTDIKEILPSQHDTPHNS-VKLTGSSTTPASVSLRQMIE 570 Query: 410 P--PDHPASADRIQSLFNDIELYPTKTQVFEMLVCHDSVRVANRSLSHSENSACLQLS 577 P P + SL +D +V L HD + S + + S C QLS Sbjct: 571 PLLSRTPPKGEFTNSL-DDTPTQSNVEKVDRFLENHDWETCSESSSASEDQSLCKQLS 627 >SPAC23H4.06 |gln1||glutamate-ammonia ligase Gln1|Schizosaccharomyces pombe|chr 1|||Manual Length = 359 Score = 29.5 bits (63), Expect = 0.39 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 305 RDIIDAHKSNKQNGMIKLKGTLAREVASAWECRVGP 412 RDI++AH I + G A + S WE +VGP Sbjct: 174 RDIVEAHYKACLYAGINISGINAEVMPSQWEYQVGP 209 >SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma catalytic subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 1018 Score = 27.1 bits (57), Expect = 2.1 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +1 Query: 109 QRVQYAQELCRSKD-VLQMPVRRVTPDITRIRASRLLSERQSRVAWNPLWSSAAVCRRDV 285 Q + A++L +KD VL+ P R D T R L + V P W A C+ + Sbjct: 421 QYAEKAKDLINTKDTVLKDPWLRQL-DWTPCNLYRKLKKATQEVPVVPKWYKKAYCKTEK 479 Query: 286 RAV 294 RAV Sbjct: 480 RAV 482 >SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 27.1 bits (57), Expect = 2.1 Identities = 9/21 (42%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +1 Query: 268 VCRRDVRA-VGSTSGHHRCSQ 327 +C++D R+ + +T GHH C Q Sbjct: 256 ICKKDYRSPIATTCGHHFCEQ 276 >SPAC23A1.18c |mrp51||mitochondrial ribosomal protein subunit L51-b |Schizosaccharomyces pombe|chr 1|||Manual Length = 291 Score = 25.4 bits (53), Expect = 6.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 346 NDQIERHFGKGGCERLGVPRGASRSSSICRSHPEPIQRHRIVSH 477 ND R+ GG + VP SR + C S+ I+R R+ +H Sbjct: 121 NDNFRRYGVSGGIQYSNVPLINSRVTPNCESNCSNIRR-RLTAH 163 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 25.4 bits (53), Expect = 6.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 245 IRYGPAPPCVAATFEQSDPPRDIIDAHKSNKQN 343 +++ P PP V ++ S PP + A+ S N Sbjct: 740 VKHHPPPPPVRSSISPSMPPAPLTHANSSTPMN 772 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,519,203 Number of Sequences: 5004 Number of extensions: 50296 Number of successful extensions: 161 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -