BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1144 (675 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 1.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 3.5 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 6.1 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.1 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = -2 Query: 341 LRYHQNLQQFKK--NYLKETKKTLTSV 267 + ++ N Q +K NYLK KTLTS+ Sbjct: 306 VNFYPNNQDIEKFLNYLKRGGKTLTSI 332 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 91 TNKRTHDEMCNEPENLALSTTDLN 20 +N +TH ++C P + L + +N Sbjct: 373 SNGQTHSQLCPTPRSTHLKVSGIN 396 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 121 ADDG-NSVMSLTNKRTHDEMCNEPENLALSTTD 26 ADD + + S T D+M ++ ENL L D Sbjct: 217 ADDSFHRLSSHTLNHNSDKMSDQQENLTLKEVD 249 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 125 VTSWQIF*RNFINFVVY 175 VTSW + +F+N V+Y Sbjct: 661 VTSWLGYMNSFVNPVIY 677 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,353 Number of Sequences: 438 Number of extensions: 2989 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -