BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1143 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_20303| Best HMM Match : Trans_reg_C (HMM E-Value=0.38) 27 9.4 >SB_41447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 4/30 (13%) Frame = +2 Query: 95 PVHLTISRTLVTSQ----DPTEHPNVNFFE 172 P H TI+ +V+S+ DP PN+NFF+ Sbjct: 205 PKHSTINHVIVSSRGPFIDPNALPNINFFK 234 >SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 349 NVNFFDFNRNPLCMLYIRACTRGVHGPQLGTHNP 450 NV F +P C ++ C G+H PQ G H+P Sbjct: 173 NVVFSPQCGSPQCGIHSTQC--GIHSPQCGIHSP 204 >SB_20303| Best HMM Match : Trans_reg_C (HMM E-Value=0.38) Length = 1354 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +2 Query: 95 PVHLTISRTLVTSQDPTEHPNVNFFEGETERVSKHCTHFAFSFARS*RHKTLPTSEC 265 P+ +TI + + P + N+N + +T+ +S+H ++ F ++ H LP + C Sbjct: 95 PIDITIYSDVSMNPGPQDKNNLNHTKTKTKNLSRHYSNLLFEIVQA--H--LPDAHC 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,134,986 Number of Sequences: 59808 Number of extensions: 435276 Number of successful extensions: 1030 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -