BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--1142
(410 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary ... 24 2.5
AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprot... 24 2.5
>DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary
secreted peptide withTIL domain protein.
Length = 85
Score = 23.8 bits (49), Expect = 2.5
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = -2
Query: 256 GLCVLCWHCN 227
G CV WHCN
Sbjct: 73 GKCVRAWHCN 82
>AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprotein
transferase protein.
Length = 103
Score = 23.8 bits (49), Expect = 2.5
Identities = 10/32 (31%), Positives = 16/32 (50%)
Frame = +3
Query: 150 ARRLQWGNISIPTIGSKRRTSRSCHWLQCQHN 245
A + QWG +PT+ S + W+ +HN
Sbjct: 36 ASQSQWGYQVLPTLYSIYQKVEVTPWISSKHN 67
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 412,319
Number of Sequences: 2352
Number of extensions: 7717
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 33349914
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -