BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1141 (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 0.28 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 4.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 6.1 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 25.4 bits (53), Expect = 0.28 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 239 QHSCRSFRGGTNKNSRCRYGY*KDRCTADS 150 Q C + G N+ C Y KD C DS Sbjct: 320 QVECYKYYGNIMVNAMCAYAKGKDACQMDS 349 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 4.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -1 Query: 96 ARSKTGTRNDSFAIMMHNKL 37 A + G RN MHNKL Sbjct: 347 AADRPGLRNTELVERMHNKL 366 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 6.1 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = +1 Query: 406 CQTCDYDGCN 435 C CD+D C+ Sbjct: 747 CHCCDFDACD 756 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,341 Number of Sequences: 438 Number of extensions: 2017 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -