BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1139 (665 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 29 0.100 AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transpor... 25 2.8 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 24 3.7 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 6.5 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 8.7 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 29.5 bits (63), Expect = 0.100 Identities = 17/75 (22%), Positives = 32/75 (42%) Frame = +2 Query: 146 HCIQDEWKHGIYF*QHQICSDANVSFIS*FDASSKRADTPDSSFLSADESDDDSVGETVS 325 HC++ ++ G + + + FD S + SS +DESDD + + Sbjct: 1889 HCVKPQYYFGNVISEQEAGRQRYNYYYKDFDLSDSSSSESSSS---SDESDDSNSSSSEE 1945 Query: 326 KKPSTNNKINRDFYT 370 +KP+ + + YT Sbjct: 1946 RKPNREHFFEKQQYT 1960 >AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transporter protein. Length = 156 Score = 24.6 bits (51), Expect = 2.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 229 ANKADIGIGANLMLLEVDSVFPLIL 155 A ADI NL +L V FPL+L Sbjct: 21 ARGADINSSRNLYILGVSFFFPLVL 45 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 24.2 bits (50), Expect = 3.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 338 LKASWRPFRLPNHHRSRQQTKNLNQGYLLFLKRH 237 L S + L + HRSRQ+++ + +G+ + RH Sbjct: 680 LNISKTEYILVSSHRSRQESQIIVEGHTIRSSRH 713 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.4 bits (48), Expect = 6.5 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 162 SGNTESTSNSIKFAPMPMSALLANLMPLQKEQIPLIQVFCLLT 290 SG S S SI + LLA ++P +PL+ F L T Sbjct: 267 SGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFT 309 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 248 KRADTPDSSFLSADESDDDS 307 +R+D+ SS S+ SDDDS Sbjct: 42 QRSDSDSSSSESSQSSDDDS 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,604 Number of Sequences: 2352 Number of extensions: 11241 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -