BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1139 (665 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.0 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.0 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.6 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.4 bits (48), Expect = 2.0 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 162 SGNTESTSNSIKFAPMPMSALLANLMPLQKEQIPLIQVFCLLT 290 SG S S SI + LLA ++P +PL+ F L T Sbjct: 268 SGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFT 310 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 162 SGNTESTSNSIKFAPMPMSALLANLMPLQKEQIPLIQVFCLLTRAMM 302 SG S S SI + LLA ++P +PL+ + L T ++ Sbjct: 264 SGEKVSLSISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMVLV 310 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 162 SGNTESTSNSIKFAPMPMSALLANLMPLQKEQIPLIQVFCLLTRAMM 302 SG S +SI + LLA ++P IPL+ + L T ++ Sbjct: 277 SGEKVSLCSSILLSLTVFFLLLAEIIPPTSLAIPLLGKYLLFTMILV 323 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,841 Number of Sequences: 438 Number of extensions: 3120 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -