BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1138 (625 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27646| Best HMM Match : CbiK (HMM E-Value=2.2) 29 2.3 SB_48122| Best HMM Match : PKD_channel (HMM E-Value=0) 29 3.1 SB_24622| Best HMM Match : F5_F8_type_C (HMM E-Value=7.4e-17) 27 9.4 SB_22259| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_27646| Best HMM Match : CbiK (HMM E-Value=2.2) Length = 423 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +2 Query: 539 SVVEYVFHYKNWYPPDIRTPVHRS---TRLH 622 S VEY+ + K WYP D+ + R+ TR+H Sbjct: 352 SAVEYISNEKGWYPYDVSMNIIRNSHYTRIH 382 >SB_48122| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1589 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/74 (22%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +2 Query: 2 SEMSISKLSRYCLQINSF-LVQDLLFGKDCEVHDLNKNRSIPIDGEFHKKYEKYFGWLDF 178 SE+ ++++ RY F L+ ++LF + + I +G + +E Y+ W++ Sbjct: 1244 SELLVTRIDRYAGNFMIFVLLCEILFVLFTVYFTYKQGKEIAREGVAYHFHE-YWSWVEL 1302 Query: 179 QIAGLASISAILFF 220 ++G + S +L+F Sbjct: 1303 VLSGCSWTSIVLYF 1316 >SB_24622| Best HMM Match : F5_F8_type_C (HMM E-Value=7.4e-17) Length = 897 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = +2 Query: 2 SEMSISKLSRYCLQINSFLVQDLLFGKDCEVHDLNKNRSIPIDGEFHKKYEK--YFGW 169 +E + K + YC Q Q ++ + E+ +P+D F + Y + FGW Sbjct: 545 TEKGMLKFTWYCKQKEESFKQHMILRNEIEIFTPRYWTILPVDSPFGRPYRERGCFGW 602 >SB_22259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 83 DCEVHDLNKNRSIPIDGEFHKKYEKYFGWL 172 D +V ++ +P DG H Y+ Y W+ Sbjct: 496 DIKVSSYLRDHCVPSDGRLHGNYQNYQAWV 525 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,899,712 Number of Sequences: 59808 Number of extensions: 411644 Number of successful extensions: 987 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 986 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -