BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1138 (625 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 25 2.0 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 25 2.0 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 3.4 AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 24 3.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 7.9 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +2 Query: 131 GEFHKKYEKYFGWLDF-QIAG 190 GE+H+++E+Y L F QI G Sbjct: 116 GEYHRRFEEYLRGLQFNQIGG 136 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +2 Query: 131 GEFHKKYEKYFGWLDF-QIAG 190 GE+H+++E+Y L F QI G Sbjct: 116 GEYHRRFEEYLRGLQFNQIGG 136 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 47 NSFLVQDLLFGKDCEVHDLNKNRSIPIDGE 136 +SF+V++L H K RS+ +DG+ Sbjct: 624 HSFIVKNLEIANKITFHPRIKTRSVTLDGD 653 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 492 KNEIFKIIICVITGGRTSCESTR 424 KNEI ++ +C+ T GR S + R Sbjct: 32 KNEINEMRVCIGTNGRMSVPANR 54 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 7.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 380 HYYFTAEIGRVVVPTRVDSQEVLP 451 H F AEIG +V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,026 Number of Sequences: 2352 Number of extensions: 13360 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -