BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1136 (667 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 26 1.2 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 25 2.1 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 25.8 bits (54), Expect = 1.2 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +3 Query: 306 FNKIPLY--WSKINMFFFFHLCFIKALVYNVLHIFFV 410 FN IPL +++ FF+ +CF++ + + L+ FV Sbjct: 369 FNYIPLQEGTTRLRYTFFYAVCFVETVAASALYGTFV 405 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 25.0 bits (52), Expect = 2.1 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -1 Query: 307 NFP*KLRFLFISITRRREIYHFCINKRKAIRGPASQKSYYFNVCEARTSCLKKR 146 +F ++ FL TRR + + C+ KR+ + K V E SC KK+ Sbjct: 276 SFADRMTFLSSKFTRRVDKFEKCVVKRRQL-----MKQNEREVVEKSKSCFKKQ 324 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,878 Number of Sequences: 2352 Number of extensions: 11999 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -