BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1136 (667 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 3.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 3.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 3.5 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 8.0 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 208 ASQKSYYFNVCEARTSCLKKRCLHY 134 AS YY N + RTS ++ +HY Sbjct: 271 ASTSLYYVNTEQFRTSDYQQNDIHY 295 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 208 ASQKSYYFNVCEARTSCLKKRCLHY 134 AS YY N + RTS ++ +HY Sbjct: 271 ASTSLYYVNTEQFRTSDYQQNDIHY 295 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 208 ASQKSYYFNVCEARTSCLKKRCLHY 134 AS YY N + RTS ++ +HY Sbjct: 271 ASTSLYYVNTEQFRTSDYQQNDIHY 295 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -1 Query: 529 RIRSRLRFSGSPAENGNQKKKRVSTVTYLFIYLFSFYKNQTKKM 398 R S+ RF +++ K +S+++ I+ + YKN KK+ Sbjct: 293 RETSKERFRDRRERERSKESKIISSLSNKTIHNNNNYKNYNKKL 336 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,269 Number of Sequences: 438 Number of extensions: 3605 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -