BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1135 (617 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069364-1|AAL39509.1| 318|Drosophila melanogaster LD06593p pro... 36 0.044 AE014134-1588|AAN10684.1| 318|Drosophila melanogaster CG13101-P... 36 0.044 AE014134-1587|AAF52731.1| 318|Drosophila melanogaster CG13101-P... 36 0.044 >AY069364-1|AAL39509.1| 318|Drosophila melanogaster LD06593p protein. Length = 318 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +2 Query: 395 ILNILGPSLISILHYRSHFQLKIPSNYNFKSWFSLDWTGHAFPFDVAIVIPI 550 + N+LG L++I HY + K+ + ++ S+F L W H ++IVI I Sbjct: 93 LTNVLGAILVTIWHYHPEYADKLLNMKSYFSYFRLYWGMHIISLVLSIVITI 144 >AE014134-1588|AAN10684.1| 318|Drosophila melanogaster CG13101-PB, isoform B protein. Length = 318 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +2 Query: 395 ILNILGPSLISILHYRSHFQLKIPSNYNFKSWFSLDWTGHAFPFDVAIVIPI 550 + N+LG L++I HY + K+ + ++ S+F L W H ++IVI I Sbjct: 93 LTNVLGAILVTIWHYHPEYADKLLNMKSYFSYFRLYWGMHIISLVLSIVITI 144 >AE014134-1587|AAF52731.1| 318|Drosophila melanogaster CG13101-PA, isoform A protein. Length = 318 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +2 Query: 395 ILNILGPSLISILHYRSHFQLKIPSNYNFKSWFSLDWTGHAFPFDVAIVIPI 550 + N+LG L++I HY + K+ + ++ S+F L W H ++IVI I Sbjct: 93 LTNVLGAILVTIWHYHPEYADKLLNMKSYFSYFRLYWGMHIISLVLSIVITI 144 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,287,174 Number of Sequences: 53049 Number of extensions: 380255 Number of successful extensions: 642 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2538517050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -