BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1135 (617 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24040.1 68417.m03454 glycosyl hydrolase family protein 37 / ... 28 5.7 At1g79915.1 68414.m09337 hypothetical protein 27 10.0 >At4g24040.1 68417.m03454 glycosyl hydrolase family protein 37 / trehalase, putative similar to trehalase 1 GMTRE1 GI:4559292 from [Glycine max] Length = 626 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 136 FRLGHFIYL*RE*SNFFIFFVFIC 65 F FIYL ++ S FF FF F+C Sbjct: 32 FSFPSFIYLKQQRSLFFFFFFFLC 55 >At1g79915.1 68414.m09337 hypothetical protein Length = 164 Score = 27.1 bits (57), Expect = 10.0 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 6 QFQRPVKKSRINHTDHAC-LLQINTKKIKKLLYSRYK*IKCPS 131 +F P NHT+H C L+ + ++ I YS + IK PS Sbjct: 14 RFDFPSLMHESNHTNHVCYLILLASRPIVYCHYSAFYHIKSPS 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,811,479 Number of Sequences: 28952 Number of extensions: 182868 Number of successful extensions: 315 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -