BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1134 (558 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 25 0.58 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 3.1 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 7.2 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 9.5 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 24.6 bits (51), Expect = 0.58 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 75 KLVKTFYFWYDLR 113 KL+K FYFW+ L+ Sbjct: 132 KLMKNFYFWFVLK 144 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = -3 Query: 328 ILCIILVNEFRVEWHVFFFSHNGIVGCRSYFF 233 ++C+++ +E V H+ + S GI+ F+ Sbjct: 261 VICVLVQSEKIVWLHLVYISFLGIICAADVFY 292 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 288 GMCFSSAIMASWGAGHTSSASPRQH 214 G+C S ++ ++GAG S+ H Sbjct: 407 GLCKESGVVKAYGAGLLSAYGELLH 431 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 54 ILTFECGKLVKTFY 95 IL F GK++K+F+ Sbjct: 80 ILVFSKGKVIKSFF 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,938 Number of Sequences: 336 Number of extensions: 3155 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -