BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1130 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.0 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 6.0 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 21 7.9 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 21 7.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 2.0 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -2 Query: 340 PVNCNTTHYRANWVPGPPSRRTRCPDPPTGGR--RHQRARQQNQCSASPVE 194 P N +A P S+ P P TGG+ R +R + +N S VE Sbjct: 1000 PQPANAQQGQAQAQAKPQSQEANKPKPATGGKGTRPKRGKYRNYDRDSLVE 1050 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 364 SHDVVKRRPVNCNTTHYRANWVPGP 290 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 395 ALQHIPLSPAGVIAKRPAPIALPNSC 472 AL P P G K AP+ L +C Sbjct: 55 ALGEAPCDPVGRRLKSLAPLVLRGAC 80 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 395 ALQHIPLSPAGVIAKRPAPIALPNSC 472 AL P P G K AP+ L +C Sbjct: 55 ALGEAPCDPVGRRLKSLAPLVLRGAC 80 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,492 Number of Sequences: 438 Number of extensions: 4071 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -