BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1129 (498 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y08110-1|CAA69325.1| 2214|Homo sapiens mosaic protein LR11 protein. 37 0.045 U60975-1|AAC50891.2| 2214|Homo sapiens gp250 precursor protein. 37 0.045 >Y08110-1|CAA69325.1| 2214|Homo sapiens mosaic protein LR11 protein. Length = 2214 Score = 36.7 bits (81), Expect = 0.045 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 5/38 (13%) Frame = -2 Query: 473 YDSRRGHATITD-----QDDDDVPPIQGFSDDEPLVIA 375 Y SR G A + +DD+D P I GFSDD P+VIA Sbjct: 2177 YSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA 2214 >U60975-1|AAC50891.2| 2214|Homo sapiens gp250 precursor protein. Length = 2214 Score = 36.7 bits (81), Expect = 0.045 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 5/38 (13%) Frame = -2 Query: 473 YDSRRGHATITD-----QDDDDVPPIQGFSDDEPLVIA 375 Y SR G A + +DD+D P I GFSDD P+VIA Sbjct: 2177 YSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA 2214 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,452,897 Number of Sequences: 237096 Number of extensions: 1077835 Number of successful extensions: 1630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1630 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -