BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1127 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 60 1e-09 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 58 8e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 51 1e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 4e-06 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 48 5e-06 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 6e-04 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 35 0.051 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 35 0.051 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 35 0.068 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 33 0.21 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 32 0.36 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 31 0.84 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 31 0.84 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 31 1.1 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_51385| Best HMM Match : DEAD (HMM E-Value=0.00031) 30 1.5 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.5 SB_34740| Best HMM Match : DEAD (HMM E-Value=0.00031) 30 1.5 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 30 1.9 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 30 1.9 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 29 3.4 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.4 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 28 5.9 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) 28 7.8 SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 7.8 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 78.2 bits (184), Expect = 6e-15 Identities = 40/125 (32%), Positives = 61/125 (48%) Frame = +1 Query: 241 PRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPD 420 P + +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 421 YVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPAKRWPTSCQPLCT*ITNPPIR 600 + ++ + Y +PT IQ Q PIA+SG+ + K K L + P ++ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQ 586 Query: 601 RGDGP 615 GDGP Sbjct: 587 VGDGP 591 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 614 PIALVLAPTRELAQQI 661 PI L+ APTREL QQI Sbjct: 591 PIVLICAPTRELCQQI 606 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +1 Query: 313 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 480 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 614 PIALVLAPTRELAQQI 661 PI LVL PTRELAQQ+ Sbjct: 133 PIVLVLCPTRELAQQV 148 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 58.0 bits (134), Expect = 6e-09 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 256 VSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQQ 432 V QPF K+FY P + K +P E +E+R E + V G P++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 433 GVKTMGYKEPTPIQAQGWPIAMSGK 507 +K Y++PTPIQAQ P+ MSG+ Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGR 143 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 57.6 bits (133), Expect = 8e-09 Identities = 25/74 (33%), Positives = 42/74 (56%) Frame = +1 Query: 286 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 465 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 466 PIQAQGWPIAMSGK 507 PIQ Q P+ +SG+ Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 50.8 bits (116), Expect = 1e-06 Identities = 34/116 (29%), Positives = 53/116 (45%), Gaps = 1/116 (0%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 451 YKEPTPIQAQGWPIAMSGKI*LA*PKRVPAKRWPTSCQPLCT*I-TNPPIRRGDGP 615 ++ PTPIQ Q MSG+ + + K S PLC + T P GD P Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSL-PLCMLLRTKAPSNPGDTP 146 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 614 PIALVLAPTRELAQQI 661 P+AL+L PTREL QQ+ Sbjct: 146 PVALILTPTRELMQQV 161 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +1 Query: 325 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 492 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 493 AMSG 504 G Sbjct: 197 MAHG 200 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 48.4 bits (110), Expect = 5e-06 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +1 Query: 337 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHINNQP 590 +D++GVA+TGSGKT A+ +P +V I P Sbjct: 139 RDIIGVAETGSGKTAAFAIPLLVWIMGLP 167 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 614 PIALVLAPTRELAQQI 661 P AL+LAPTRELAQQI Sbjct: 179 PYALILAPTRELAQQI 194 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 331 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 Score = 33.5 bits (73), Expect = 0.16 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHINN 584 +D++ AQTGSGKT A++LP + + N Sbjct: 749 RDVMACAQTGSGKTAAFLLPVMTSMMN 775 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 596 FGEVMVPIALVLAPTRELAQQI 661 F E P A+ +APTRELA QI Sbjct: 783 FSETQTPQAMCIAPTRELANQI 804 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 331 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHI 578 +D++G A+TGSGKTLA+ +P I HI Sbjct: 169 RDIIGAAETGSGKTLAFGIPIIQHI 193 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 361 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 VSG I F E F + + + GY+ PTP+Q PI M+G+ Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 Score = 35.9 bits (79), Expect = 0.029 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHINNQ 587 +DL+ AQTGSGKT AY+LP + + Q Sbjct: 517 RDLMACAQTGSGKTAAYMLPVLTSLIKQ 544 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +2 Query: 614 PIALVLAPTRELAQQI 661 P+AL +APTRELA+QI Sbjct: 553 PLALCVAPTRELAKQI 568 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 36.7 bits (81), Expect = 0.017 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 438 KDNGLQRTDAHPSSRLADSYVWKDLVGVAQTGSGKTLAYILPAI 569 KD G +A +DL+G A+TGSGKTLA+++P + Sbjct: 588 KDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVV 631 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 35.1 bits (77), Expect = 0.051 Identities = 13/22 (59%), Positives = 20/22 (90%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAI 569 +D++G A+TGSGKTLA+++P I Sbjct: 88 RDVLGAAKTGSGKTLAFLIPII 109 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 ++ F + G+ G+ PT IQ QG P+A+SG+ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGR 88 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 35.1 bits (77), Expect = 0.051 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHINNQPAY 596 +D+ GVA GSGK LAY+LP I I Y Sbjct: 225 RDVAGVAIEGSGKRLAYLLPIIHQITESSVY 255 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHINNQP 590 KD++G+A+TGSGKT A+ LP + + + P Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNP 30 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAI--VHINNQPA 593 +DL+ AQTGSGKT A+++P + +++ PA Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRIYMEGPPA 944 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 I FE+ + + + V GYK+PTP+Q PI + GK Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPI-VKGK 912 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHINNQP 590 +D +G A+TGSGKT A+ LP + + + P Sbjct: 45 RDCIGCAKTGSGKTAAFALPILQKLCDDP 73 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 504 KDLVGVAQTGSGKTLAYILPAIVHINNQPA 593 KD+V +A+TGSGKT A+++P + A Sbjct: 319 KDVVAMARTGSGKTAAFLIPMFEKLQTHTA 348 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +3 Query: 495 YVWKDLVGVAQTGSGKTLAYILPAI 569 Y +D++G A+TG+GKTL++ LP + Sbjct: 108 YDGEDVIGQARTGTGKTLSFALPLV 132 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 31.1 bits (67), Expect = 0.84 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 510 LVGVAQTGSGKTLAYILPAIVH 575 ++ AQTGSGKTLAY+ P +VH Sbjct: 418 VICAAQTGSGKTLAYLAP-LVH 438 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 31.1 bits (67), Expect = 0.84 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +1 Query: 346 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 501 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGK 507 + V +G+ PTPIQA P+A+ GK Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGK 48 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 474 SSRLADSYVWKDLVGVAQTGSGKTLAYILPAIVHINNQP 590 +S + + + KD+ A TG+GKT A++LP + + +P Sbjct: 38 ASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRP 76 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 373 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 486 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_51385| Best HMM Match : DEAD (HMM E-Value=0.00031) Length = 127 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +3 Query: 483 LADSYVWKDLVGVAQTGSGKTLAY-ILPAIVH 575 L Y+ KD++ V TG GK+L + +LPA++H Sbjct: 10 LESLYLNKDVLAVLPTGYGKSLVFHLLPALLH 41 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 268 VGVKQIPIWASHVLPSREF 212 VGV+ I WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 319 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_34740| Best HMM Match : DEAD (HMM E-Value=0.00031) Length = 233 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +3 Query: 483 LADSYVWKDLVGVAQTGSGKTLAY-ILPAIVH 575 L Y+ KD++ V TG GK+L + +LPA++H Sbjct: 116 LESLYLNKDVLAVLPTGYGKSLVFHLLPALLH 147 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 620 ALVLAPTRELAQQI 661 ALVLAPTRELAQQI Sbjct: 162 ALVLAPTRELAQQI 175 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPAK 543 FE+ + G+ G+ +P+PIQ + P+A++G+ LA K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPAK 543 FE+ + G+ G+ +P+PIQ + P+A++G+ LA K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 203 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 93 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 227 QNMRRPDWDLFHSNLSTKTFMIHILQFSKD 316 +N RR WD FHSN+S + H+ F D Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDFDTD 795 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 331 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 423 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 614 PIALVLAPTRELAQQI 661 P ALVL+PTRELA QI Sbjct: 4 PQALVLSPTRELANQI 19 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 614 PIALVLAPTRELAQQI 661 P ALVL+PTRELA QI Sbjct: 66 PQALVLSPTRELANQI 81 >SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) Length = 968 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -1 Query: 657 CCANSLVGAKTKAIGTITSPNRRVGYLCAQWLARCRPTFCRNPFGLRQLN 508 C A++L+G+ + I +T RRV Y C RC P + FGL N Sbjct: 156 CQASNLLGSVERLI-YVTQWCRRVCYCCLFDSHRCSPGLEPDVFGLHMQN 204 >SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 278 LLKGWSETNPNLGVACSAL 222 LLKGW TN N +AC+A+ Sbjct: 150 LLKGWGATNFNHAMACAAV 168 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 7.8 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -2 Query: 269 GWSETNPNLGVACS--ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFH 99 GW T + S AL+RI + ++ C +YRR CC L +W H + Sbjct: 181 GWRVTLRVIAATTSQQALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTN 239 Query: 98 GYYSN 84 Y+S+ Sbjct: 240 TYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,110,129 Number of Sequences: 59808 Number of extensions: 434261 Number of successful extensions: 1246 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1243 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -