Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1126
         (619 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5CX96 Cluster: Putative uncharacterized protein; n=4; ...    33   5.5  

>UniRef50_Q5CX96 Cluster: Putative uncharacterized protein; n=4;
            Cryptosporidium|Rep: Putative uncharacterized protein -
            Cryptosporidium parvum Iowa II
          Length = 2333

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 8/64 (12%)
 Frame = -3

Query: 437  NLTLATKRLQLCST*RYHCDA--------FR*IIWCFYVSKTNVYLKNGSVLYETCMMII 282
            N TL+TK L L  T +Y   +        F+ I     V KTN +LKN ++LY  C  ++
Sbjct: 1069 NSTLSTKVLLLTITIKYGLFSNLSVIENWFKEIYTFVQVYKTNSHLKNWNLLYHNCRKVV 1128

Query: 281  KYFS 270
            K +S
Sbjct: 1129 KNYS 1132


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 507,352,753
Number of Sequences: 1657284
Number of extensions: 8883251
Number of successful extensions: 12557
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12255
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12556
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)