BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1126 (619 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.07 |ubp10||ubiquitin C-terminal hydrolase Ubp10|Schizosa... 27 2.9 SPAC24B11.14 ||SPAC806.10|sequence orphan|Schizosaccharomyces po... 25 6.6 >SPBC577.07 |ubp10||ubiquitin C-terminal hydrolase Ubp10|Schizosaccharomyces pombe|chr 2|||Manual Length = 502 Score = 26.6 bits (56), Expect = 2.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 159 ILHIALYNMIFTLISFPSCPRTVREPAMFILNLI*HK 269 + H+ + F L +F +CP+ V+ A+ I L HK Sbjct: 196 LAHVKPFRNYFLLKNFDNCPQLVQRLAILIRKLWNHK 232 >SPAC24B11.14 ||SPAC806.10|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 25.4 bits (53), Expect = 6.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 394 QVLHSCNRLVARVKLSSYMTFRPYGTLQLRINNN 495 + LH C RL++ S+ TF PY +N N Sbjct: 7 KTLHVCLRLISLRNCSNTWTFVPYANSNRGLNIN 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,259,150 Number of Sequences: 5004 Number of extensions: 42278 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -