BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1126 (619 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0202 - 18430330-18430484,18430617-18430756,18431316-18431389 31 0.97 >03_04_0202 - 18430330-18430484,18430617-18430756,18431316-18431389 Length = 122 Score = 30.7 bits (66), Expect = 0.97 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +3 Query: 123 NLTNSLRLHSIYILHIALYNMIFTLISFPSCPRTVREPAMFILNLI*HKTK 275 N +NS R H I+ LH A Y+ FT +P+ + +PA+FIL + H++K Sbjct: 18 NNSNSQRRHHIHQLH-ASYS--FTHSPYPNKEHS-SDPALFILRYLYHRSK 64 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,071,797 Number of Sequences: 37544 Number of extensions: 224781 Number of successful extensions: 271 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -