Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1126
         (619 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_04_0202 - 18430330-18430484,18430617-18430756,18431316-18431389     31   0.97 

>03_04_0202 - 18430330-18430484,18430617-18430756,18431316-18431389
          Length = 122

 Score = 30.7 bits (66), Expect = 0.97
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +3

Query: 123 NLTNSLRLHSIYILHIALYNMIFTLISFPSCPRTVREPAMFILNLI*HKTK 275
           N +NS R H I+ LH A Y+  FT   +P+   +  +PA+FIL  + H++K
Sbjct: 18  NNSNSQRRHHIHQLH-ASYS--FTHSPYPNKEHS-SDPALFILRYLYHRSK 64


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,071,797
Number of Sequences: 37544
Number of extensions: 224781
Number of successful extensions: 271
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 264
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 271
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1490248872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)