BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1125 (597 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 75 3e-14 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 75 3e-14 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 69 2e-12 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 6e-11 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 61 6e-10 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 61 6e-10 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 61 6e-10 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 61 6e-10 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 61 6e-10 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 61 6e-10 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 61 6e-10 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 61 6e-10 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 61 6e-10 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 61 6e-10 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 61 6e-10 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 55 4e-08 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 34 0.10 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) 29 2.2 SB_42282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 27 8.7 SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) 27 8.7 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) 27 8.7 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 76.2 bits (179), Expect = 2e-14 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +2 Query: 383 CPGPHARYTEGISMFSLA*RP-GQPAETPSCWGLGFAIIPHKREFLVSASHKLALITSLP 559 C GPHARYT+G++ L+ G + ++ EFLVSASH+LALITSLP Sbjct: 2 CSGPHARYTDGVNESFLSTEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 61 Query: 560 FVHTARRYYRLN 595 FVHTARRYYRLN Sbjct: 62 FVHTARRYYRLN 73 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 75.4 bits (177), Expect = 3e-14 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +2 Query: 383 CPGPHARYTEGISMFSLA*RP-GQPAETPSCWGLGFAIIPHKREFLVSASHKLALITSLP 559 C GPHARYT+G++ L + G + ++ EFLVSASH+LALITSLP Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Query: 560 FVHTARRYYRLN 595 FVHTARRYYRLN Sbjct: 62 FVHTARRYYRLN 73 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 75.4 bits (177), Expect = 3e-14 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +2 Query: 383 CPGPHARYTEGISMFSLA*RP-GQPAETPSCWGLGFAIIPHKREFLVSASHKLALITSLP 559 C GPHARYT+G++ L + G + ++ EFLVSASH+LALITSLP Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Query: 560 FVHTARRYYRLN 595 FVHTARRYYRLN Sbjct: 62 FVHTARRYYRLN 73 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 69.3 bits (162), Expect = 2e-12 Identities = 37/70 (52%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +2 Query: 389 GPHARYTEGISMFSLA*RP-GQPAETPSCWGLGFAIIPHKREFLVSASHKLALITSLPFV 565 G HARYT+G++ L + G + ++ EFLVSASH+LALITSLPFV Sbjct: 7 GRHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 66 Query: 566 HTARRYYRLN 595 HTARRYYRLN Sbjct: 67 HTARRYYRLN 76 Score = 33.1 bits (72), Expect = 0.18 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 372 MPLDVLGR-TRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 MPLDVLGR R T + +G GN +K RAGD LQL NE Sbjct: 1 MPLDVLGRHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLIFNE 47 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 64.5 bits (150), Expect = 6e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +2 Query: 488 AIIPHKREFLVSASHKLALITSLPFVHTARRYYRLN 595 AII EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 3 AIIDLNEEFLVSASHQLALITSLPFVHTARRYYRLN 38 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 63.3 bits (147), Expect = 1e-10 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = +2 Query: 389 GPHARYTEGIS-MFSLA*RPGQPAETPSCWGLGFAIIPHKREFLVSASHKLALITSLPFV 565 G RYT+G++ F G + ++ EFLVSASH+LALITSLPFV Sbjct: 7 GRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFV 66 Query: 566 HTARRYYRLN 595 HTARRYYRLN Sbjct: 67 HTARRYYRLN 76 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/47 (55%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 372 MPLDVLGRTRA-TLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 MPLDVLGRTR T + P P G GN +K RAGD LQL NE Sbjct: 1 MPLDVLGRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNE 47 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 62.1 bits (144), Expect = 3e-10 Identities = 39/70 (55%), Positives = 46/70 (65%), Gaps = 1/70 (1%) Frame = +2 Query: 389 GPHARYTEGISMFSLA*RPGQPAETPSCWGLGFAIIPHKREF-LVSASHKLALITSLPFV 565 GPHARYT+G++ L + W + AII +R VSASH+LALITSLPFV Sbjct: 7 GPHARYTDGVNESFLRRK---------AWII--AIIDLERGIPSVSASHQLALITSLPFV 55 Query: 566 HTARRYYRLN 595 HTARRYYRLN Sbjct: 56 HTARRYYRLN 65 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 91 EFLVSASHQLALITSLPFVHTARRYYRLN 119 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 163 EFLVSASHQLALITSLPFVHTARRYYRLN 191 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R +++ C+ G GN +K RAGD LQL NE Sbjct: 126 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNE 162 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 47 EFLVSASHQLALITSLPFVHTARRYYRLN 75 Score = 44.8 bits (101), Expect = 5e-05 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = +3 Query: 372 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 MPLDVLGRTRATL S + G GN +K RAGD +L NE Sbjct: 1 MPLDVLGRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKLLIFNE 46 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 110 EFLVSASHQLALITSLPFVHTARRYYRLN 138 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R +++ C+ G GN +K RAGD LQL NE Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNE 109 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 48 EFLVSASHQLALITSLPFVHTARRYYRLN 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +3 Query: 372 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINE 509 MPLDVLGR R TL S + R G GN +K RAGD LQL +NE Sbjct: 1 MPLDVLGRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQLLILNE 47 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 24 EFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 38 EFLVSASHQLALITSLPFVHTARRYYRLN 66 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 44 EFLVSASHQLALITSLPFVHTARRYYRLN 72 Score = 36.3 bits (80), Expect = 0.019 Identities = 20/40 (50%), Positives = 22/40 (55%) Frame = +3 Query: 390 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 GRTRATL P P G GN +K RAGD +L NE Sbjct: 4 GRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNE 43 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 24 EFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 48 EFLVSASHQLALITSLPFVHTARRYYRLN 76 Score = 47.6 bits (108), Expect = 8e-06 Identities = 28/47 (59%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = +3 Query: 372 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINE 509 MPLDVLGRTRATL S + R G GN +K RAGD LQL +NE Sbjct: 1 MPLDVLGRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQLLILNE 47 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 202 EFLVSASHQLALITSLPFVHTARRYYRLN 230 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R +++ C+ G GN +K RAGD LQL +NE Sbjct: 165 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNE 201 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 110 EFLVSASHQLALITSLPFVHTARRYYRLN 138 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 38 EFLVSASHQLALITSLPFVHTARRYYRLN 66 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 158 EFLVSASHQLALITSLPFVHTARRYYRLN 186 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R ++++ C+ G GN +K RAGD LQL NE Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNE 157 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 24 EFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 47 EFLVSASHQLALITSLPFVHTARRYYRLN 75 Score = 51.6 bits (118), Expect = 5e-07 Identities = 28/46 (60%), Positives = 30/46 (65%) Frame = +3 Query: 372 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 MPLDVL RTRATL S P P G GN +K RAGD LQL +NE Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQLLILNE 46 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 158 EFLVSASHQLALITSLPFVHTARRYYRLN 186 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R ++++ C+ G GN +K RAGD LQL +NE Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNE 157 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 110 EFLVSASHQLALITSLPFVHTARRYYRLN 138 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R +++ C+ G GN +K RAGD LQL +NE Sbjct: 73 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQLLILNE 109 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 99 EFLVSASHQLALITSLPFVHTARRYYRLN 127 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 24 EFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 84 EFLVSASHQLALITSLPFVHTARRYYRLN 112 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R +++ C+ G GN +K RAGD LQL +NE Sbjct: 47 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNE 83 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 161 EFLVSASHQLALITSLPFVHTARRYYRLN 189 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 127 EFLVSASHQLALITSLPFVHTARRYYRLN 155 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 435 PRGPGNPLKLLRAGDWGLQLSPINE 509 P+G GN +K RAGD LQL NE Sbjct: 102 PQGVGNLVKHRRAGDRSLQLLIFNE 126 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 163 EFLVSASHQLALITSLPFVHTARRYYRLN 191 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R ++++ C+ G GN +K RAGD LQL +NE Sbjct: 126 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLILNE 162 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 110 EFLVSASHQLALITSLPFVHTARRYYRLN 138 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R +++ C+ G GN +K RAGD LQL NE Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNE 109 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 61.3 bits (142), Expect = 6e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 24 EFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 60.1 bits (139), Expect = 1e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSA+H+LALITSLPFVHTARRYYRLN Sbjct: 67 EFLVSANHQLALITSLPFVHTARRYYRLN 95 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +3 Query: 435 PRGPGNPLKLLRAGDWGLQLSPINE 509 P+G GN +K RAGD LQL +NE Sbjct: 42 PQGVGNLVKHRRAGDRSLQLLILNE 66 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 58.4 bits (135), Expect = 4e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 509 EFLVSASHKLALITSLPFVHTARRYYRLN 595 EFLVSASH+LALITSLPFVHTAR YYRLN Sbjct: 110 EFLVSASHQLALITSLPFVHTARGYYRLN 138 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 399 RATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINE 509 R +++ C+ G GN +K RAGD LQL +NE Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQLLILNE 109 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 15 VSASHQLALITSLPFVHTARRYYRLN 40 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 92 VSASHQLALITSLPFVHTARRYYRLN 117 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 518 VSASHKLALITSLPFVHTARRYYRLN 595 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 596 HSIGSSDGRCVQRAGT*STRAYDSRLLGI 510 HSIGSSDGRCVQRAGT S D RLLGI Sbjct: 37 HSIGSSDGRCVQRAGTQSMHIDDMRLLGI 65 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 36.3 bits (80), Expect = 0.019 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 596 HSIGSSDGRCVQRAG 552 HSIGSSDGRCVQRAG Sbjct: 28 HSIGSSDGRCVQRAG 42 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 418 DSFSVARVRPRTSKGITD 365 D+ SVARVRPRTSKGITD Sbjct: 34 DTVSVARVRPRTSKGITD 51 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 418 DSFSVARVRPRTSKGITD 365 D+ SVARVRPRTSKGITD Sbjct: 132 DTVSVARVRPRTSKGITD 149 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 418 DSFSVARVRPRTSKGITD 365 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 418 DSFSVARVRPRTSKGITD 365 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 418 DSFSVARVRPRTSKGITD 365 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 418 DSFSVARVRPRTSKGITD 365 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVAHVRPRTSKGITD 81 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.5 bits (68), Expect = 0.53 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 418 DSFSVARVRPRTSKGITD 365 D+ SVARVR +TSKGITD Sbjct: 64 DTVSVARVRAKTSKGITD 81 >SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +3 Query: 372 MPLDVLGRTRATLKES 419 MPLDVLGRTRATL S Sbjct: 1 MPLDVLGRTRATLTVS 16 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 372 MPLDVLGRTRATL 410 MPLDVLGRTRATL Sbjct: 1 MPLDVLGRTRATL 13 >SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) Length = 1197 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 128 PVSGPGEISRVESN*AAGSTPGGALPSIPLSFSFAT 21 P S PG S A STPG A+ SIP + S +T Sbjct: 1015 PSSTPGAASSTTPGAAPSSTPGAAMSSIPGATSSST 1050 >SB_42282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 222 PELTRQIAPPTKNGHAPPPTESRKSC*SVNPSGVRAW*DF 103 PE T ++A PT + APPP + S S P+G+R+ D+ Sbjct: 117 PESTAKVAVPTTSP-APPPPSTVTSTTSKPPTGLRSKYDY 155 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +2 Query: 8 PGGVWLQS*NLKELTEGHHQEWSLRLNLTQH---GKSHQARTPEGLTD*QLFLDSVGGGA 178 P W+ + NLK + G WSL L+ G H P+ LTD L + S+ GA Sbjct: 475 PDDSWVSTSNLKTASPGEQYSWSLFRALSHMLCIGYGHY--PPQNLTDLWLTVCSMTAGA 532 >SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) Length = 556 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 511 FSFMGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVA 401 + + G P P R S GLPG + + +DSFS+A Sbjct: 365 WKYQGFKVYPDYPKRISNWGLPGKVDELAPSDSFSLA 401 >SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 596 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 416 ISMFSLA*RPGQPAETPSCWGLGFAIIPHKREFLVSASHKLAL 544 +++FS+ P ++P C L F+ + H+R S SH L L Sbjct: 186 LTLFSILINP----DSPLCLRLKFSFVSHERRTRSSTSHNLVL 224 >SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) Length = 428 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/69 (28%), Positives = 31/69 (44%) Frame = -1 Query: 360 YCSISCGSKTPVPLRRILIRRQ*VARHEAAHT*ITSLFSRLESRSLPELTRQIAPPTKNG 181 YCS P+ LR+I+I + VA+ A+ + R S L + ++ +G Sbjct: 193 YCSRFVAVVDPL-LRQIVISQFKVAKASIAYRIVLYFIHRTRYYSGARLDQPLSARRLDG 251 Query: 180 HAPPPTESR 154 H PP SR Sbjct: 252 HNTPPCRSR 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,875,276 Number of Sequences: 59808 Number of extensions: 475857 Number of successful extensions: 1234 Number of sequences better than 10.0: 89 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1222 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -