BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1124 (675 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 21 7.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.0 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 9.2 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 9.2 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 468 LKNR*SWNQAMRMSCGSGSTTKADYNH 548 +KN+ SW Q ++ K+ YNH Sbjct: 90 IKNKPSWWQELQEKYDPKGEYKSRYNH 116 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.0 Identities = 13/56 (23%), Positives = 21/56 (37%) Frame = +2 Query: 359 KKPVPKAENPQPSVDLSFFQSPPQNLKRTIEVIEHEIEKQVILESSDEDELWKWLY 526 K P +P S +F + +K +E E + + + SDE W Y Sbjct: 1121 KMQYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYMEAPQDNVSQPSDEVMENSWFY 1176 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.0 Identities = 13/56 (23%), Positives = 21/56 (37%) Frame = +2 Query: 359 KKPVPKAENPQPSVDLSFFQSPPQNLKRTIEVIEHEIEKQVILESSDEDELWKWLY 526 K P +P S +F + +K +E E + + + SDE W Y Sbjct: 1121 KMQYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYMEAPQDNVSQPSDEVMENSWFY 1176 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 347 NTAAKKPVPKAENPQPSVD 403 +T P P NPQ VD Sbjct: 452 STTEAPPAPAVSNPQNEVD 470 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 138 PCFSCELKQNKTSHELNIIANVNLI 64 P F +LK LNII+N++ + Sbjct: 369 PLFLTQLKDECPEVRLNIISNLDCV 393 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,303 Number of Sequences: 336 Number of extensions: 3894 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -