BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1123 (650 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0EF46 Cluster: Chromosome undetermined scaffold_92, wh... 38 0.28 UniRef50_Q4P8E9 Cluster: Putative uncharacterized protein; n=1; ... 37 0.48 >UniRef50_A0EF46 Cluster: Chromosome undetermined scaffold_92, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_92, whole genome shotgun sequence - Paramecium tetraurelia Length = 2467 Score = 37.5 bits (83), Expect = 0.28 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -3 Query: 333 SELICFMCIYTDFFSCIKCSKLRNVLISNRLC 238 +E +C C DF+SCI C RN +++N+LC Sbjct: 452 TEGLCNECEQQDFYSCISCKSGRNRILANKLC 483 >UniRef50_Q4P8E9 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 489 Score = 36.7 bits (81), Expect = 0.48 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +3 Query: 42 HSPPDVKSSTT*IPHPL*DISSKISV*LTRLP--HHSNRNALLLHGRNRRGGD 194 H+ PDV S + + D S K+ V TR P H+ + +++HGRNR G D Sbjct: 63 HTQPDVPSGSRLTSIDVGDSSHKLGVYWTRNPSNRHAKQAFVMIHGRNRNGAD 115 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 586,272,935 Number of Sequences: 1657284 Number of extensions: 10475905 Number of successful extensions: 19353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19353 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 48760335122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -