BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1122 (457 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128517-1|BAC87476.1| 901|Homo sapiens protein ( Homo sapiens ... 30 4.3 AB040936-1|BAA96027.2| 4464|Homo sapiens KIAA1503 protein protein. 30 4.3 >AK128517-1|BAC87476.1| 901|Homo sapiens protein ( Homo sapiens cDNA FLJ46675 fis, clone TRACH3009701, weakly similar to Homo sapiens dynein, axonemal, heavy polypeptide 9 (DNAH9). ). Length = 901 Score = 29.9 bits (64), Expect = 4.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 222 MQ*LSIVLALEKDSISFCFHSVEVNNLSNNAIDP 323 MQ + IV +L +D ++FC S + NL + I+P Sbjct: 724 MQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEP 757 >AB040936-1|BAA96027.2| 4464|Homo sapiens KIAA1503 protein protein. Length = 4464 Score = 29.9 bits (64), Expect = 4.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 222 MQ*LSIVLALEKDSISFCFHSVEVNNLSNNAIDP 323 MQ + IV +L +D ++FC S + NL + I+P Sbjct: 3823 MQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEP 3856 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,301,379 Number of Sequences: 237096 Number of extensions: 1222958 Number of successful extensions: 2042 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2042 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3815180866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -