BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1120 (556 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 27 0.17 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.2 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 23 2.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 6.3 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.4 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.4 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 26.6 bits (56), Expect = 0.17 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 279 KIPDWFLNRQKDIVDGKYSQLTSSNLDSKLRED-LERLKKI 398 KI WFL++ K+I+D Y L +++ +L D L R K+I Sbjct: 275 KIDKWFLHKMKNIID-YYLVLENTDHTKQLSHDVLLRAKQI 314 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 306 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 404 + D + QLTSS +S + D +LK IRA Sbjct: 1781 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1813 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 306 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 404 + D + QLTSS +S + D +LK IRA Sbjct: 1777 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1809 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 124 PFVCHRCSYS 95 PF C +CSYS Sbjct: 16 PFKCEKCSYS 25 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.4 bits (43), Expect = 6.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 154 VGRRYSNIVLKKADIDLDKRAGECTEEEVEKIIT 255 +G+R S V K A T +E+EKI T Sbjct: 3 LGQRISGAVAVLRGTSEVKEAQTSTSDEIEKITT 36 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 202 DQCRLF*EQCWS 167 D+C EQCWS Sbjct: 829 DECWRLMEQCWS 840 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 202 DQCRLF*EQCWS 167 D+C EQCWS Sbjct: 867 DECWRLMEQCWS 878 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,270 Number of Sequences: 438 Number of extensions: 3434 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -