BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1118 (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 5.3 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.3 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.3 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.9 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 9.2 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 300 NMMQIRIPVTVSEITVGNSSGTDRCRSTCLVRYG*YV 190 +++ ++ + S++ G SSG RST RY +V Sbjct: 149 HVLMVQRMIGSSQLGTGGSSGYQYLRSTLSDRYKVFV 185 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 300 NMMQIRIPVTVSEITVGNSSGTDRCRSTCLVRYG*YV 190 +++ ++ + S++ G SSG RST RY +V Sbjct: 309 HVLMVQRMIGSSQLGTGGSSGYQYLRSTLSDRYKVFV 345 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 300 NMMQIRIPVTVSEITVGNSSGTDRCRSTCLVRYG*YV 190 +++ ++ + S++ G SSG RST RY +V Sbjct: 309 HVLMVQRMIGSSQLGTGGSSGYQYLRSTLSDRYKVFV 345 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 546 SVCRYVQRNCRFICHCESCVC*VSIIVIQKVLLTKLSSI 430 + R+ + N R I + V I+++QK KLS + Sbjct: 307 TAARFFELNRRTILGVSNAVITFLIVMVQKASYEKLSPV 345 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 325 EHVRSTAKKHDADQNTSN 272 E V+ AKK ++D N +N Sbjct: 448 EVVQEEAKKEESDSNNNN 465 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,131 Number of Sequences: 336 Number of extensions: 3248 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -