BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1110 (656 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces p... 28 1.0 SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces ... 28 1.4 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 7.3 SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosa... 25 9.6 >SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 258 Score = 28.3 bits (60), Expect = 1.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 157 SKMHTRVRERRLFGSDGGDQHLWRQRSKVILYTTSAGTS 273 S + TRV+ F GG QHL+R S V++ T + +S Sbjct: 29 STIITRVQSSLSFQQAGGFQHLYRGLSSVLVSTLPSASS 67 >SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 110 RVGSKRASCYKSDGKPQRCIPEFENAAYLVQ 202 +VG KR C+++ G C EFEN Y ++ Sbjct: 449 QVGYKRL-CFRTKGNGPMCFVEFENIPYAME 478 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.4 bits (53), Expect = 7.3 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +1 Query: 475 RPQSFAIYKKTTKTKFGSH--SNIS-VPHVEKLTELKSRKVLN 594 +P+ A KT + FGSH SN S VP KLT KS + N Sbjct: 400 KPKEKATLGKTVNSFFGSHSTSNYSKVPLSAKLTGEKSDDLSN 442 >SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1029 Score = 25.0 bits (52), Expect = 9.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 190 GGVLELWYASLRFSIGFITRGSFRADPRRLVIILSHGYAQDTEQI 56 GG+ + + S+ ++ I G F L+ +H YAQD E++ Sbjct: 718 GGLTKEFLTSICKTVFDINYGLFSETKAHLLYPNTHAYAQDVERL 762 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,804,863 Number of Sequences: 5004 Number of extensions: 59443 Number of successful extensions: 149 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -