BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1109 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0005 + 46370-46454,46962-47071,47381-47545,47672-48463,487... 31 0.88 >03_01_0005 + 46370-46454,46962-47071,47381-47545,47672-48463, 48730-48840,48935-49195,49415-49638,49735-49855, 50673-51214,51302-51488,51569-51895,52047-52197, 52287-52424,52918-53013,53276-53357,54411-54679, 54769-54882,55050-55288,55488-55715,55799-55951, 56479-56616,57061-57188,57598-57718,58142-58306, 59486-59633,59772-59898,60025-60118,60119-60268, 60577-60624,60712-60819,61040-61114,61225-61275, 61341-61487,61584-61714,61944-62031,62204-62266, 62336-62582,62830-62981,63056-63126,63214-63370, 63520-63687 Length = 2323 Score = 31.1 bits (67), Expect = 0.88 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 4/75 (5%) Frame = +3 Query: 369 IAINTKLYSSVCLSVTFSRLRNGFD---EAW*ENRLSLGKLYKLPFI-SQLARVPHSRDL 536 + INT+LY+ V ++V F L + E L GKL+ L + S + SR+L Sbjct: 1773 VFINTELYARVSVAVLFDHLWKQIEVKSTLETEEALRSGKLFLLKLLDSAVNDKDISREL 1832 Query: 537 YFRPRSPNRRRTKVY 581 Y + S +RR+ +++ Sbjct: 1833 YKKYSSVHRRKVRIW 1847 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,685,506 Number of Sequences: 37544 Number of extensions: 252733 Number of successful extensions: 410 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -