BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1109 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) 28 8.4 >SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 31.9 bits (69), Expect = 0.51 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +2 Query: 104 PTINKNNNTSEFVGNNFSTIESFPQKTKEGFYSYFL 211 PT++ NNN+SE + +N + ++ P+K+K F SY + Sbjct: 248 PTLHSNNNSSESLPSN-TPLKETPRKSKFNFKSYVM 282 >SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) Length = 600 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -3 Query: 171 KLSIVEKLFPTNSDVLLFLLIVGQFSHEITFAVTARIRLSKRRGV 37 +L+ V+ F T DVLL LL + ++ +TAR+ S +GV Sbjct: 93 RLNPVQLSFATQLDVLLVLLEILDYARNDGLNLTARVSSSGTQGV 137 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,268,156 Number of Sequences: 59808 Number of extensions: 331319 Number of successful extensions: 651 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -