BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1109 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 7.0 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 7.0 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 7.0 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 23 9.2 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 9.2 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 74 TANVISCEN*PTINKNNNTSEFVGNNFSTIESFPQKTKE 190 ++N + N + N NNNT NN +++ P + KE Sbjct: 196 SSNNSNNNNNSSSNNNNNTISSNNNNNNSLHHGPLRDKE 234 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 74 TANVISCEN*PTINKNNNTSEFVGNNFSTIESFPQKTKE 190 ++N + N + N NNNT NN +++ P + KE Sbjct: 196 SSNNSNNNNNSSSNNNNNTISSNNNNNNSLHHGPLRDKE 234 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 74 TANVISCEN*PTINKNNNTSEFVGNNFSTIESFPQKTKE 190 ++N + N + N NNNT NN +++ P + KE Sbjct: 148 SSNNSNNNNNSSSNNNNNTISSNNNNNNSLHHGPLRDKE 186 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 23.0 bits (47), Expect = 9.2 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Frame = -2 Query: 514 RANCEMK-----GSLYNFP---RLNLFSYQASSKPFLRRENVTDRQTELYSFV 380 RAN E++ G +++ P +L LFS + P R N D EL+ F+ Sbjct: 155 RANTEIEDFIGEGDVFSLPPCHKLMLFSGVSVLTPLAIRFNPADTALELFQFI 207 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 113 NKNNNTSEFVGNNFSTIESFPQKTKE 190 N NNNT NN +++ P + KE Sbjct: 209 NNNNNTISSNNNNNNSLHHGPLRDKE 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,157 Number of Sequences: 2352 Number of extensions: 11496 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -