BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1109 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 25 0.91 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.1 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 23 3.7 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 4.9 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 6.4 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 24.6 bits (51), Expect = 0.91 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 113 NKNNNTSEFVGNNFSTIESFP 175 N N N ++ N+ T+ SFP Sbjct: 367 NTNTNDQDYSSQNYLTVHSFP 387 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 570 FFADSGCVGENINRVSEGRVL 508 F +GCV NR+S RVL Sbjct: 26 FRISAGCVSRISNRISRNRVL 46 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 275 KVRESPFVHSEICTNKQKERQKENNCKNLL-*FSEGNFQL 159 K + + H ++C E KE C+N F G+F L Sbjct: 18 KGKNASQAHKKLCAVYGDEALKERQCQNWFDKFRSGDFSL 57 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 396 SVCLSVTFSRLRNGFDEAW*ENRLSLGK 479 +V L V FS+ GFDE E++++L K Sbjct: 385 TVQLIVEFSKRLPGFDELMREDQIALLK 412 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 499 MKGSLYNFPRLNLFSYQASSKPFLRRE 419 M +LY P + Y ++KPF++ E Sbjct: 262 MTNNLYYSPLSSRSLYYVNTKPFMKSE 288 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,180 Number of Sequences: 438 Number of extensions: 3588 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -