BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1108 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0294 + 22022630-22024006,22024109-22024234,22024319-220244... 29 2.3 11_06_0278 - 21854859-21855101,21855529-21855587,21855684-218557... 29 2.3 06_01_0092 - 775290-775691 28 7.0 05_06_0240 - 26629218-26629323,26629412-26629490,26629656-266297... 28 7.0 >11_06_0294 + 22022630-22024006,22024109-22024234,22024319-22024423, 22024525-22024659,22024798-22024847,22026487-22026545, 22026819-22026928,22027941-22028174,22028278-22028377, 22028699-22028829,22029834-22029914,22029970-22030128 Length = 888 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 516 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 614 L+R + PF SW N +A D+ + L LNG Sbjct: 399 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNG 431 >11_06_0278 - 21854859-21855101,21855529-21855587,21855684-21855711, 21855812-21856702,21856792-21857011,21857638-21857687, 21863174-21863284,21863379-21863483,21863568-21863693, 21863796-21865187 Length = 1074 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 516 LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 614 L+R + PF SW N +A D+ + L LNG Sbjct: 404 LSRPSRQDPFTSWDNMRQACLDKGTHALGKLNG 436 >06_01_0092 - 775290-775691 Length = 133 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 574 RASSLLRQLAKGGCAARR 521 RA+SLLRQL + GCAA + Sbjct: 22 RAASLLRQLIEDGCAAAK 39 >05_06_0240 - 26629218-26629323,26629412-26629490,26629656-26629761, 26629844-26629947,26630069-26630168,26630256-26630351, 26630464-26630541,26630603-26630671,26630766-26630846, 26630879-26630935,26631016-26631105,26631192-26631278, 26631690-26631794,26631899-26631994,26632222-26632397, 26632847-26633006,26633151-26633600 Length = 679 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 574 RASSLLRQLAKGGCAARRLSWVRQGFPSHDV 482 R L RQL++GGC +RL W R G+ + +V Sbjct: 94 RGLLLARQLSRGGCGEQRL-WAR-GYAAKEV 122 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,195,093 Number of Sequences: 37544 Number of extensions: 319249 Number of successful extensions: 672 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -