BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1108 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 134 7e-32 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 134 7e-32 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 134 7e-32 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 129 2e-30 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 3e-20 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 88 5e-18 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 88 5e-18 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 88 5e-18 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 88 5e-18 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 88 5e-18 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 88 5e-18 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 88 5e-18 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 88 5e-18 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 88 5e-18 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 88 5e-18 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 88 5e-18 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 88 5e-18 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 88 5e-18 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 88 5e-18 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 88 5e-18 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 88 5e-18 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 88 5e-18 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 88 5e-18 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 88 5e-18 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 88 5e-18 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 88 5e-18 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 88 5e-18 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 88 5e-18 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 88 5e-18 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 88 5e-18 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 88 5e-18 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 88 5e-18 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 88 5e-18 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 88 5e-18 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 88 5e-18 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 88 5e-18 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 88 5e-18 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 88 5e-18 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 88 5e-18 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 88 5e-18 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 88 5e-18 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 88 5e-18 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 88 5e-18 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 88 5e-18 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 88 5e-18 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 88 5e-18 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 88 5e-18 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 88 5e-18 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 88 5e-18 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 88 5e-18 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 88 5e-18 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 5e-18 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 87 1e-17 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 87 1e-17 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 87 1e-17 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 87 1e-17 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 87 1e-17 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 87 1e-17 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 87 1e-17 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 87 1e-17 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 87 1e-17 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 87 1e-17 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 87 1e-17 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 87 1e-17 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 87 1e-17 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 87 1e-17 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 87 1e-17 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 87 1e-17 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 87 1e-17 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 87 1e-17 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 87 1e-17 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 87 1e-17 SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) 87 1e-17 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 87 1e-17 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 87 1e-17 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 87 1e-17 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 87 1e-17 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 87 1e-17 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 87 1e-17 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 87 1e-17 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 87 1e-17 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 87 1e-17 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 87 1e-17 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 87 1e-17 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 87 1e-17 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 87 1e-17 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 87 1e-17 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 87 1e-17 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 87 1e-17 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 87 1e-17 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 87 1e-17 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 87 1e-17 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 87 1e-17 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 87 1e-17 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 87 1e-17 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 87 1e-17 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 87 1e-17 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 87 1e-17 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 87 1e-17 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 87 1e-17 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 87 1e-17 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 87 1e-17 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 87 1e-17 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 87 1e-17 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 87 1e-17 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 87 1e-17 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 87 1e-17 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 87 1e-17 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 87 1e-17 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 87 1e-17 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 86 3e-17 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 85 3e-17 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 85 3e-17 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 85 3e-17 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 85 3e-17 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 85 3e-17 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 85 3e-17 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 85 3e-17 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 85 3e-17 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 85 3e-17 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 85 3e-17 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 85 3e-17 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 85 3e-17 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 85 3e-17 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 85 3e-17 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 85 3e-17 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 85 3e-17 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 85 3e-17 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 85 3e-17 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 134 bits (323), Expect = 7e-32 Identities = 60/63 (95%), Positives = 60/63 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGFPSHDVVKRRPVNCNTTHYR 440 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645 Query: 439 ANW 431 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 134 bits (323), Expect = 7e-32 Identities = 60/63 (95%), Positives = 60/63 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGFPSHDVVKRRPVNCNTTHYR 440 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 439 ANW 431 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 134 bits (323), Expect = 7e-32 Identities = 60/63 (95%), Positives = 60/63 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGFPSHDVVKRRPVNCNTTHYR 440 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 439 ANW 431 ANW Sbjct: 89 ANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 129 bits (311), Expect = 2e-30 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -2 Query: 607 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGFPSHDVVKRRPVNCNTTHYRANW 431 +LRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 105 bits (251), Expect = 4e-23 Identities = 49/52 (94%), Positives = 49/52 (94%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGFPSHDVVKRRPV 464 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GFPSHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPV 67 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 95.5 bits (227), Expect = 3e-20 Identities = 44/54 (81%), Positives = 46/54 (85%) Frame = +3 Query: 465 TGRRFTTS*LGKPWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 TGRRFT P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 90.6 bits (215), Expect = 9e-19 Identities = 42/54 (77%), Positives = 44/54 (81%) Frame = +3 Query: 465 TGRRFTTS*LGKPWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 TGRR P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 90.6 bits (215), Expect = 9e-19 Identities = 42/54 (77%), Positives = 44/54 (81%) Frame = +3 Query: 465 TGRRFTTS*LGKPWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 TGRR P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 90.6 bits (215), Expect = 9e-19 Identities = 42/54 (77%), Positives = 44/54 (81%) Frame = +3 Query: 465 TGRRFTTS*LGKPWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 TGRR P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 90.6 bits (215), Expect = 9e-19 Identities = 42/54 (77%), Positives = 44/54 (81%) Frame = +3 Query: 465 TGRRFTTS*LGKPWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 TGRR P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 90.6 bits (215), Expect = 9e-19 Identities = 42/54 (77%), Positives = 44/54 (81%) Frame = +3 Query: 465 TGRRFTTS*LGKPWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 TGRR P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 88.6 bits (210), Expect = 4e-18 Identities = 48/68 (70%), Positives = 49/68 (72%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGFPSHDVVKRRPVNCNTTHYR 440 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF RR C TT Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKTT--- 53 Query: 439 ANWVPGPP 416 A+ PG P Sbjct: 54 ASEFPGDP 61 Score = 85.4 bits (202), Expect = 3e-17 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 620 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 97 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/49 (44%), Positives = 28/49 (57%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL*YDSL 444 GR++ A + + G + + TPGFSQSRRCKTTASE D L Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 472 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 512 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 483 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 256 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 227 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 65 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 105 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 76 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 646 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 686 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 657 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 411 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 382 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 327 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 298 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 555 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 595 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 566 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 84.6 bits (200), Expect = 6e-17 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 510 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 620 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 530 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 566 Score = 36.3 bits (80), Expect = 0.020 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTA 468 GR++ A + + G + + TPGFSQSRRCKTTA Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 Score = 34.7 bits (76), Expect = 0.062 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWEN GV L L P Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHP 539 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 67 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 38 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 72 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 43 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 22 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 301 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 272 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 188 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 228 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 199 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 485 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 456 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 320 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 291 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 170 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 141 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 914 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 954 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 925 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 621 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 592 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 262 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 302 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 273 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 535 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 506 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTASEL 459 GR++ A + + G + + TPGFSQSRRCKTTASEL Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 81.4 bits (192), Expect = 5e-16 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 621 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 520 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 85 AIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 68 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 108 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 79 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 88.2 bits (209), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVRQGF 497 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWV GF Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 590 GRAIGAGLFAITPAGERGMCCKAIKLGTPGFSQSRRCKTTAS 465 GR++ A + + G + + TPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 37 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHP 49 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 40 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 41 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 30 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 845 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHP 857 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 126 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 51 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 23 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHP 35 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 31 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 49 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 144 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHP 156 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 165 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHP 177 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 33 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 59 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 35.5 bits (78), Expect = 0.036 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 L VVLQRRDWENPGV L L P Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHP 71 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 72 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 225 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHP 237 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 45 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 60 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 52 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 87 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHP 99 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/49 (42%), Positives = 26/49 (53%) Frame = +1 Query: 394 TINISYSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVPNLIALQHIP 540 T++I+++ G LAVVLQRRDWENPGV L L P Sbjct: 33 TLSIAFAGEGGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 112 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 40 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 158 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 71 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 112 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/65 (36%), Positives = 31/65 (47%) Frame = +1 Query: 346 LCSQIDIIGNKAKQVYTINISYSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVPNLIA 525 +C D++ + + + IS G P+ LAVVLQRRDWENPGV L Sbjct: 62 MCRASDLLWSVERLIDLAAISIRGGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNR 119 Query: 526 LQHIP 540 L P Sbjct: 120 LAAHP 124 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 1202 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 82.6 bits (195), Expect = 2e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 512 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHP 1214 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 44 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 137 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHP 149 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 89 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHP 101 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 43 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 48 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 108 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHP 120 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 73 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 52 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 33 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 77 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 36 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 120 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 36 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 55 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 88 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHP 100 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 79 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 103 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHP 115 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 1075 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHP 1087 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 43 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 146 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 194 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHP 206 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 182 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 223 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHP 194 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 71 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 31 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 158 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 39.5 bits (88), Expect = 0.002 Identities = 26/77 (33%), Positives = 32/77 (41%), Gaps = 5/77 (6%) Frame = +1 Query: 325 SYTRTIVLCSQIDIIGNKAKQVYTINISYSRGGPVXXXXXXXXXXXX-----LAVVLQRR 489 +Y R +V + + K V I + GP+ LAVVLQRR Sbjct: 6 AYVRPLVSYRRAQAVSTSPKPVCIIVLGICSAGPIQKEGDPLESTCRHASLALAVVLQRR 65 Query: 490 DWENPGVPNLIALQHIP 540 DWENPGV L L P Sbjct: 66 DWENPGVTQLNRLAAHP 82 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 128 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHP 140 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 35 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHP 47 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 664 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHP 676 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 51 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 173 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 59 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/63 (38%), Positives = 30/63 (47%) Frame = +1 Query: 352 SQIDIIGNKAKQVYTINISYSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVPNLIALQ 531 SQ+ G ++ + + Y G P+ LAVVLQRRDWENPGV L L Sbjct: 11 SQLSYFGTFMYRLGLLGLKYDEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLA 68 Query: 532 HIP 540 P Sbjct: 69 AHP 71 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 44 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 72 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 68.5 bits (160), Expect = 4e-12 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 507 RTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 617 R + +++AHPPFASWRNSEEARTDRPSQQLRSLNGE Sbjct: 9 REKGGQVSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 83 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 91 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 197 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 456 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHP 468 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 278 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHP 290 >SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) Length = 1710 Score = 86.6 bits (205), Expect = 1e-17 Identities = 39/45 (86%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = -2 Query: 619 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW-VRQGFPSH 488 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW + Q P H Sbjct: 769 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWDILQNIPGH 813 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 73 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 116 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 75 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 86 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHP 98 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 95 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 188 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHP 200 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 43 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 95 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 154 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHP 166 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 80 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 50 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 56 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 93 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 203 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 244 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHP 215 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 99 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHP 111 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 116 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 50 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 62 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 138 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 55 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/65 (38%), Positives = 32/65 (49%) Frame = +1 Query: 346 LCSQIDIIGNKAKQVYTINISYSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVPNLIA 525 L +Q+ + A +V + + RG P+ LAVVLQRRDWENPGV L Sbjct: 31 LINQLRFVFQAADKVGQLLLFDQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNR 88 Query: 526 LQHIP 540 L P Sbjct: 89 LAAHP 93 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 30 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 66 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 106 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHP 118 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 77 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 179 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHP 191 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 54 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 45 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 91 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 466 LAVVLQRRDWENPGVPNLIALQHIP 540 LAVVLQRRDWENPGV L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 86.6 bits (205), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 501 PWRTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQI 626 P TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/58 (43%), Positives = 29/58 (50%) Frame = +1 Query: 367 IGNKAKQVYTINISYSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVPNLIALQHIP 540 I + A Q + S+S G P+ LAVVLQRRDWENPGV L L P Sbjct: 26 IASSAYQKWPTRNSHSLGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,263,086 Number of Sequences: 59808 Number of extensions: 388490 Number of successful extensions: 7883 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7849 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -