BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1108 (626 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 24 4.5 AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 24 4.5 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 24 4.5 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 245 KTQNWHNRIKIKHNSLFSKFSLITDS*VTHVP 340 K + ++ KHN++F + L+T V VP Sbjct: 653 KKKQCRDKYLAKHNAVFDQLDLVTYEEVVKVP 684 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 23.8 bits (49), Expect = 4.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 501 PWRTQLNRLAAHP 539 PWRTQ++ LA P Sbjct: 348 PWRTQVDALAVRP 360 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 23.8 bits (49), Expect = 4.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 501 PWRTQLNRLAAHP 539 PWRTQ++ LA P Sbjct: 348 PWRTQVDALAVRP 360 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,514 Number of Sequences: 2352 Number of extensions: 12646 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -