Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1108
         (626 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative calcium/c...    24   4.5  
AJ441131-4|CAD29633.1|  566|Anopheles gambiae putative apyrase/n...    24   4.5  
AJ439398-3|CAD28126.1|  566|Anopheles gambiae putative 5' nucleo...    24   4.5  

>CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative
           calcium/calmodulin-dependentprotein kinase, CAKI
           protein.
          Length = 872

 Score = 23.8 bits (49), Expect = 4.5
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = +2

Query: 245 KTQNWHNRIKIKHNSLFSKFSLITDS*VTHVP 340
           K +   ++   KHN++F +  L+T   V  VP
Sbjct: 653 KKKQCRDKYLAKHNAVFDQLDLVTYEEVVKVP 684


>AJ441131-4|CAD29633.1|  566|Anopheles gambiae putative
           apyrase/nucleotidase protein.
          Length = 566

 Score = 23.8 bits (49), Expect = 4.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 501 PWRTQLNRLAAHP 539
           PWRTQ++ LA  P
Sbjct: 348 PWRTQVDALAVRP 360


>AJ439398-3|CAD28126.1|  566|Anopheles gambiae putative 5'
           nucleotidase protein.
          Length = 566

 Score = 23.8 bits (49), Expect = 4.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 501 PWRTQLNRLAAHP 539
           PWRTQ++ LA  P
Sbjct: 348 PWRTQVDALAVRP 360


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,514
Number of Sequences: 2352
Number of extensions: 12646
Number of successful extensions: 14
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61050630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)