BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1107 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27.03 |meu25||sequence orphan|Schizosaccharomyces pombe|chr ... 29 0.87 SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 27 2.6 SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 27 2.6 SPAC1039.03 |||esterase/lipase |Schizosaccharomyces pombe|chr 1|... 27 2.6 SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex ... 27 3.5 SPBC428.01c |nup107|SPBC582.11c|nucleoporin Nup107|Schizosacchar... 25 8.1 >SPBC27.03 |meu25||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 28.7 bits (61), Expect = 0.87 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +2 Query: 539 PDLLSVQRSTALVRASVSNELTYQSERSWKLFQGLPLR 652 PDL+ VQ STA SV ELT + KL P R Sbjct: 517 PDLVCVQTSTAETFLSVDRELTTYDLNTIKLLNTAPSR 554 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 27.1 bits (57), Expect = 2.6 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 254 CQLLVVYMKVCYFIFLNFENHTILYII*FHNNANPSTTYIVCL 126 CQLL++++ VC F+N + Y I HN+ S + I L Sbjct: 3842 CQLLMLFLPVCE-QFINLAESVLDYFINVHNSNLDSLSKISTL 3883 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 27.1 bits (57), Expect = 2.6 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 158 ANPSTTYIVCLCKKKNTNIRVPFDV*--YCLLHDENVLQLFSLK 33 ++PSTT+ C +I+ F+V YC+LH +N L+ F K Sbjct: 432 SHPSTTF----CSNVENDIKEIFEVCKDYCMLHVQNNLKAFEEK 471 >SPAC1039.03 |||esterase/lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 341 Score = 27.1 bits (57), Expect = 2.6 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +2 Query: 485 NIFCILTNDP*HNPLNFSPDLLSVQRSTALVRASVSNELTYQSERSWKLFQGLP 646 NI +L++ +P NF P +L + LV N ++ +SW+LF+ P Sbjct: 185 NIAAVLSHKVAASPANFPPLVLQL-----LVVPVCDNTANAKTHKSWELFENTP 233 >SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex subunit Sld3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 668 Score = 26.6 bits (56), Expect = 3.5 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -1 Query: 521 CVMGRWSICKKYLEFICMFSSVRRIYFGNQMAYHIILKVKVIISDFYLGFGHI 363 C+ RW I K+Y EF C SS++ I ++ +VK ++ +G H+ Sbjct: 36 CICLRWCISKEYHEFTC--SSLQFIVIRPAGTSVLLGRVKSSKANQLVGIEHV 86 >SPBC428.01c |nup107|SPBC582.11c|nucleoporin Nup107|Schizosaccharomyces pombe|chr 2|||Manual Length = 794 Score = 25.4 bits (53), Expect = 8.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 616 LGLVGELIANTGSNKSSASLNRE 548 LGL ELI N+ SN S AS+ E Sbjct: 368 LGLTPELIFNSLSNSSIASIQEE 390 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,922,815 Number of Sequences: 5004 Number of extensions: 62434 Number of successful extensions: 154 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -