BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1107 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 26 0.31 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 26 0.31 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.0 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 21 8.7 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 22 YILYLREKSCKTFSSCSKQYHTSNGTRMLVFFFLHRHTM 138 Y Y+RE SS QYH R +++FLH+ M Sbjct: 233 YYYYMREMLPYWMSS--SQYHMPKEIRGQLYYFLHKQLM 269 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 22 YILYLREKSCKTFSSCSKQYHTSNGTRMLVFFFLHRHTM 138 Y Y+RE SS QYH R +++FLH+ M Sbjct: 233 YYYYMREMLPYWMSS--SQYHMPKEIRGQLYYFLHKQLM 269 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 375 FWTHHYKVQFAHLSAYLPYRFSLNNSFTIF 286 FW HH++ ++ + S PY N ++T F Sbjct: 429 FWEHHFQCRYPNASV-TPY----NKNYTKF 453 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/46 (23%), Positives = 20/46 (43%) Frame = -3 Query: 294 TIFSIKINLFTFILSITGGVYEGVLFYFFEFRKSHYIIYNLIS*QC 157 T+F+ I T +L G ++F F+ + +NL+ C Sbjct: 111 TVFTYNITNSTPLLKKLYGGNSTIIFLLIRFKSFSLLNFNLLFFNC 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,236 Number of Sequences: 438 Number of extensions: 4248 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -