BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1105 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0877 + 21230447-21230815,21231855-21232208,21232417-212325... 31 0.64 01_06_1183 - 35176780-35177266,35179631-35181093 29 4.5 02_05_0940 - 32934214-32934906,32936049-32936185,32936281-329364... 28 7.8 >10_08_0877 + 21230447-21230815,21231855-21232208,21232417-21232504, 21232844-21233268,21233477-21233632,21233849-21234016, 21234170-21234310,21234393-21234629,21234710-21234823, 21235096-21235272 Length = 742 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +3 Query: 264 SVEASAGDGKIQRFQLITPDRTFEFGTQDHKSRLQWISSLRQA 392 S S D K RF +ITP +T + T K R+ WI +L A Sbjct: 126 SFSESKSDDK--RFYIITPTKTLQLRTGSAKDRVAWIEALVSA 166 >01_06_1183 - 35176780-35177266,35179631-35181093 Length = 649 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 322 IGLLSSALRIIKVASNGYRRCVKRPQSRVVLKA 420 +GL L ++ +AS RRC P+S LKA Sbjct: 144 LGLADDVLDVLALASRQCRRCSPAPESEEALKA 176 >02_05_0940 - 32934214-32934906,32936049-32936185,32936281-32936416, 32936503-32936886 Length = 449 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 171 ILVRAAALRPHILQELVAEGAMRQDRHREYCSVEAS 278 + A A R ++ + AEGAMR+ HR SV S Sbjct: 405 VAAAAKAKRRYVASAVHAEGAMRKGEHRYASSVSGS 440 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,742,036 Number of Sequences: 37544 Number of extensions: 281148 Number of successful extensions: 809 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -